close all open/close all

CDS information : Madu_00190


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction33,501 / 32,644 / - [in whole cluster]
33,501 / 32,644 / - [in contig]
Locationcomplement(32644..33501) [in whole cluster]
complement(32644..33501) [in contig]
TypeCDS
Length858 bp (285 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative acyltransferase
Product (GenBank)acetyltransferase/esterase
Gene
Gene (GenBank)mdpB3
EC number
Keyword
  • 3,6-dimethylsalicylic acid
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q8GHB5
PmId
[16276503] Acyl transfer in clorobiocin biosynthesis: involvement of several proteins in the transfer of the pyrrole-2-carboxyl moiety to the deoxysugar. (Chembiochem. , 2005)
ACC
Q9F8U0
PmId
[16834331] Installation of the pyrrolyl-2-carboxyl pharmacophore by CouN1 and CouN7 in the late biosynthetic steps of the aminocoumarin antibiotics clorobiocin and coumermycin A1. (Biochemistry. , 2006)

close this sectionSequence

selected fasta
>putative acyltransferase [acetyltransferase/esterase]
MTRAPGREPAAGLLAVPGADLYYEIRGAGPALLLIPTGNGDAGPYAPLADALADRHTVIT
YDRRGYSRSPMHAPVDGARRVAVDARDASLLIERLAAGPAAALGGSSGAVVALALLERHP
DTVRTLVAHEPPLASVLPDAAEWRRFYADLYDTYRRIGARPARAEFRARMGMTGDTRPPE
EAQPPPAELERMLGRIRGNLDRWFEEELRPYPSYPLDTAALGRVAGRLVLAGGRDSRDHH
PYEPNTVLAKRFGLDIADFPGGHVGYVTHPFEFAERLAEVLAGAR
selected fasta
>putative acyltransferase [acetyltransferase/esterase]
GTGACCCGGGCCCCCGGGCGCGAACCGGCCGCGGGGCTGCTGGCGGTGCCCGGCGCCGAT
CTCTACTACGAGATCCGCGGCGCCGGGCCCGCCCTGCTGCTGATCCCCACGGGCAACGGT
GACGCCGGACCCTACGCGCCGCTGGCGGACGCGCTGGCCGACCGCCACACCGTCATCACC
TACGACCGGCGCGGCTACTCCCGCAGCCCGATGCACGCCCCGGTCGACGGCGCGCGGCGC
GTCGCGGTCGACGCGCGCGACGCGAGCCTGCTGATCGAGCGGCTGGCCGCCGGGCCCGCC
GCCGCGCTGGGCGGCAGTTCCGGCGCCGTGGTCGCCCTCGCGCTGCTGGAACGCCACCCG
GACACCGTGCGGACGCTCGTCGCGCACGAGCCGCCGCTGGCCTCGGTGCTGCCGGACGCG
GCCGAATGGCGCCGGTTCTACGCCGACCTGTACGACACGTACCGGCGGATCGGCGCGCGT
CCGGCCCGCGCGGAGTTCCGCGCGCGGATGGGGATGACCGGGGACACCCGGCCGCCGGAG
GAGGCGCAGCCGCCGCCCGCGGAGCTGGAGCGGATGCTCGGCCGGATCCGGGGCAACCTG
GACCGCTGGTTCGAGGAGGAACTCCGCCCCTACCCGTCCTACCCCCTCGACACGGCGGCG
CTGGGACGGGTCGCGGGCCGGCTCGTCCTGGCGGGCGGCCGCGACTCGCGCGACCACCAC
CCCTACGAGCCCAACACCGTGCTGGCGAAGCGGTTCGGCCTCGACATCGCGGACTTCCCC
GGCGGCCACGTCGGCTACGTGACCCACCCCTTCGAGTTCGCCGAACGGCTCGCGGAGGTG
CTCGCCGGGGCCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit