close all open/close all

CDS information : Madu_00200


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction34,898 / 33,498 / - [in whole cluster]
34,898 / 33,498 / - [in contig]
Locationcomplement(33498..34898) [in whole cluster]
complement(33498..34898) [in contig]
TypeCDS
Length1,401 bp (466 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase
Product (GenBank)glycosyltransferase
Gene
Gene (GenBank)mdpA6
EC number
Keyword
  • madurose
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q9RPA2
NITE
Urd_00030
PmId
[10662691] Function of glycosyltransferase genes involved in urdamycin A biosynthesis. (Chem Biol. , 2000)
[11094336] The NDP-sugar co-substrate concentration and the enzyme expression level influence the substrate specificity of glycosyltransferases: cloning and characterization of deoxysugar biosynthetic genes of the urdamycin biosynthetic gene cluster. (Chem Biol. , 2000)
ACC
Q9L555
NITE
Acla_00030
PmId
[15078101] AknK is an L-2-deoxyfucosyltransferase in the biosynthesis of the anthracycline aclacinomycin A. (Biochemistry. , 2004)
[17685523] Characterization of rhodosaminyl transfer by the AknS/AknT glycosylation complex and its use in reconstituting the biosynthetic pathway of aclacinomycin A. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>putative glycosyltransferase [glycosyltransferase]
MRVLFVVYPSHAHLWPAVPTAWALQSAGHEVRVATHANFSASVTAAGLTPVQLGDADAVE
ARMRPDAKPPARPEEVLHFADVLGLNERERENWIPYYQWLLNPISDYVRTDLPEAGDLID
FACAWRPDLIVWDPTFASGPVAARLCGAAHARMVLGPDYLSWSFDRLAERRDAVRAAGLP
ESPQHELLRPLAEKHGVELDDELLYGQWSLDPMPPGMRLPTSGITVPMRYVPYNGAEIMP
KWLYERPSRPRVALTLGESTRRFIKGDWGRTPKIFEAVAGLDIEVVATLNDLQMEGIERL
PDNVRAIEWVPLTHLLPTCDVMINHGGIGTTAAAWGLRTPQIVCDTDDTLMMRPVEVDPR
TMEDGTYRVGFEFGVREEVEMVTTWELPPKKLEAGPTSDYIVSRGAGARLDHTKLSVAEV
ADVISAVVEDPAYRKGAQDVYDEWLGLPSPAGIVPQLEQLTAEHRR
selected fasta
>putative glycosyltransferase [glycosyltransferase]
ATGCGGGTCCTGTTCGTCGTCTACCCTTCCCACGCGCATCTCTGGCCGGCCGTGCCGACC
GCGTGGGCATTGCAAAGTGCCGGGCACGAGGTCCGTGTCGCCACCCATGCGAATTTCAGC
GCGTCGGTCACGGCGGCGGGACTGACCCCCGTCCAGCTCGGTGACGCCGACGCGGTCGAG
GCGCGCATGCGGCCCGACGCCAAGCCGCCCGCGCGGCCCGAGGAGGTGCTCCACTTCGCG
GACGTGCTCGGGCTTAACGAGCGGGAGCGCGAGAACTGGATCCCCTACTACCAGTGGCTG
CTGAACCCGATCTCGGACTACGTCCGCACGGACCTGCCCGAGGCGGGCGACCTCATCGAC
TTCGCGTGCGCCTGGCGGCCCGACCTGATCGTCTGGGACCCCACCTTCGCGTCCGGTCCC
GTGGCGGCACGGCTCTGCGGCGCCGCGCACGCCCGCATGGTGCTGGGCCCCGACTACCTC
TCGTGGAGCTTCGACCGGCTCGCCGAGCGCCGCGACGCGGTCCGGGCCGCGGGCCTGCCC
GAGAGCCCCCAGCACGAGCTGCTGCGCCCGCTCGCCGAGAAGCACGGCGTCGAGCTCGAC
GACGAGCTGCTGTACGGCCAGTGGTCGCTGGACCCCATGCCGCCGGGCATGCGGCTGCCG
ACGAGCGGGATCACGGTGCCGATGCGCTACGTGCCGTACAACGGCGCCGAGATCATGCCG
AAGTGGCTGTACGAGCGGCCCAGCCGCCCGCGGGTCGCGCTGACGCTCGGTGAGTCCACC
CGCCGGTTCATCAAGGGCGACTGGGGCCGCACCCCGAAGATCTTCGAGGCGGTGGCCGGT
CTCGACATCGAGGTGGTCGCCACGCTCAACGACCTGCAGATGGAGGGGATCGAGCGGCTG
CCCGACAACGTCCGGGCGATCGAATGGGTGCCGCTGACCCACCTCCTGCCCACCTGCGAC
GTGATGATCAACCACGGCGGCATCGGGACGACCGCCGCGGCCTGGGGGCTGCGGACGCCG
CAGATCGTCTGCGACACCGACGACACCCTGATGATGCGTCCCGTCGAGGTGGACCCCCGG
ACCATGGAGGACGGCACGTACCGCGTCGGCTTCGAGTTCGGCGTCCGGGAGGAGGTCGAG
ATGGTCACCACCTGGGAGCTGCCGCCCAAGAAGCTGGAGGCCGGCCCGACGTCGGACTAC
ATCGTGTCGCGCGGCGCGGGCGCCCGGCTGGACCACACGAAGCTGTCGGTCGCCGAGGTC
GCCGACGTGATCAGCGCCGTGGTGGAGGACCCGGCGTACCGCAAGGGCGCGCAGGACGTC
TACGACGAGTGGCTCGGCCTCCCGAGCCCGGCCGGCATCGTGCCGCAGCTGGAGCAGCTG
ACGGCAGAGCACCGGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-72]  2.6e-12 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [210-305]  7e-32 PF06722
PF06722   DUF1205
SignalP No significant hit
TMHMM No significant hit