close all open/close all

CDS information : Madu_00210


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction35,059 / 35,796 / + [in whole cluster]
35,059 / 35,796 / + [in contig]
Location35059..35796 [in whole cluster]
35059..35796 [in contig]
TypeCDS
Length738 bp (245 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)DNA alkylation repair
Gene
Gene (GenBank)mdpR4
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [DNA alkylation repair]
MPEELTAAAFLERMEPLKPHRATDDLVRHFRAGPGEVAEGDVFNGVRMGDIFKLAKEFVG
MPCAEIEKLLEDQVHEVRVGALSIMGKDATRKKITMERRKELYDLYLRRIDRVNHWDLVD
LSSHHVIGGYLYESGEPRGVLYELARSDNLWARRIAVFSTMYFVRRGDLDDTFEISEILA
YDDQDLVQKAVGGMLREAGKQDRPRLLSFLDEHAAGAPRIMLRYAIEHLDKPQRTHYLNL
GKQAR
selected fasta
>hypothetical protein [DNA alkylation repair]
ATGCCGGAAGAACTCACCGCAGCCGCGTTTCTGGAAAGAATGGAACCGCTCAAGCCCCAT
CGGGCGACCGACGACCTGGTCCGGCACTTCCGGGCGGGCCCCGGCGAGGTCGCCGAGGGC
GACGTCTTCAACGGCGTCCGCATGGGCGACATCTTCAAGCTGGCCAAGGAATTCGTCGGG
ATGCCCTGCGCCGAGATCGAGAAGCTGCTCGAGGACCAGGTGCACGAGGTGCGCGTCGGC
GCGCTCAGCATCATGGGCAAGGACGCCACCCGCAAGAAGATCACCATGGAGCGCCGCAAG
GAGCTCTACGACCTGTACCTGCGCCGCATCGACCGGGTCAACCATTGGGACCTGGTCGAC
CTGAGCAGCCACCACGTCATCGGCGGCTACCTGTACGAATCCGGAGAGCCCCGCGGCGTC
CTGTACGAACTCGCCCGGTCCGACAACTTGTGGGCGCGGCGCATCGCCGTGTTCAGCACC
ATGTACTTCGTCCGCCGCGGCGACCTGGACGACACTTTCGAAATCTCGGAAATTCTCGCC
TACGACGACCAGGACCTGGTGCAGAAGGCCGTCGGCGGAATGCTCCGCGAGGCGGGCAAG
CAGGACCGCCCCCGCCTGCTCTCCTTCCTCGACGAGCACGCCGCCGGCGCACCGCGCATC
ATGCTGCGCTACGCGATCGAGCATCTCGACAAGCCGCAGCGCACCCACTACCTGAACCTG
GGCAAGCAGGCCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014825 DNA alkylation repair enzyme (Family)
 [20-229]  8.50000000000004e-52 PF08713
PF08713   DNA_alkylation
IPR016024 Armadillo-type fold (Domain)
 [16-232]  7.49999605851445e-38 SSF48371
SSF48371   ARM-type_fold
SignalP No significant hit
TMHMM No significant hit