close all open/close all

CDS information : Madu_00230


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction38,229 / 37,084 / - [in whole cluster]
38,229 / 37,084 / - [in contig]
Locationcomplement(37084..38229) [in whole cluster]
complement(37084..38229) [in contig]
TypeCDS
Length1,146 bp (381 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)mdpU2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MSAHTERGVARTGPELRGVAYDTGTNFATGQGDLSRTSWSGPQMREEVAAIADQLNCNSI
TVYGSDMDRLRETAVAALDLDLHVRLQPRLVDRPQAEVLEHLAEAAALGETLRADGGRVE
LTVGAVHLLFTPGIVPGDQYHERMANIYADADHHLLTPTDTVDTAAAAPRLNEFLGRAAT
VARGAFHGPVSYSAAHFEDVDWTPFDLIGLMYQYLPKARTRAGHLDLIGGYRRWGKPILI
AEFGTATYRGAEDKAFFFWDIVDRAGEPPVILPGHVRDEAAQSAYHLEMFDVFEEAGVHG
VAVSEFIHPTHPHTTDETLDLDMASMAIVKTIRDDFGDPASSYRWEPKESYHAIADYYAH
VGFQAAARAGSAAGEAIGSRS
selected fasta
>hypothetical protein [hypothetical protein]
ATGTCAGCACACACCGAACGGGGCGTCGCGCGGACCGGGCCGGAACTGCGCGGCGTCGCC
TACGACACCGGCACCAACTTCGCCACCGGTCAGGGCGACCTCTCGCGGACGTCGTGGAGC
GGCCCGCAGATGCGGGAGGAGGTCGCCGCGATCGCCGACCAGCTCAACTGCAACTCGATC
ACCGTGTACGGCAGCGACATGGACCGGCTGCGGGAGACGGCCGTCGCGGCGCTCGACCTG
GACCTGCACGTGCGGCTCCAGCCCCGCCTGGTGGACCGTCCGCAGGCGGAGGTCCTGGAG
CACCTCGCGGAGGCGGCCGCGCTCGGCGAGACGCTGCGCGCGGACGGCGGCCGGGTCGAG
CTGACGGTCGGCGCCGTGCACCTGCTGTTCACCCCCGGGATCGTCCCCGGTGACCAGTAC
CACGAGCGGATGGCCAACATCTACGCCGACGCCGACCACCACCTGCTCACCCCCACCGAC
ACGGTCGACACGGCGGCCGCGGCGCCCCGGCTCAACGAGTTCCTGGGGCGGGCCGCCACG
GTGGCGCGCGGCGCGTTCCACGGGCCGGTCAGCTACTCGGCCGCGCATTTCGAGGACGTC
GACTGGACGCCGTTCGACCTGATCGGCCTGATGTACCAGTACCTGCCGAAGGCCCGGACG
CGCGCGGGGCACCTCGACCTGATCGGCGGCTACCGCAGGTGGGGCAAGCCGATCCTCATC
GCCGAGTTCGGCACCGCGACCTACCGCGGCGCCGAGGACAAGGCGTTCTTCTTCTGGGAC
ATCGTCGACCGTGCCGGGGAGCCGCCGGTGATCCTGCCCGGCCACGTCCGGGACGAGGCG
GCCCAGTCGGCCTACCACCTGGAGATGTTCGACGTCTTCGAGGAGGCGGGCGTGCACGGG
GTGGCGGTGTCGGAGTTCATCCACCCGACCCATCCGCACACCACCGACGAGACCCTCGAC
CTGGACATGGCGAGCATGGCCATCGTGAAGACCATCCGCGACGACTTCGGCGACCCGGCC
TCGTCCTACCGCTGGGAGCCGAAGGAGTCCTACCACGCCATCGCCGACTACTACGCCCAC
GTGGGTTTCCAGGCCGCCGCCCGCGCGGGGTCCGCCGCCGGCGAGGCGATCGGGAGCCGG
TCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR017853 Glycoside hydrolase, superfamily (Domain)
 [23-363]  2.10000037262656e-06 SSF51445
SSF51445   Glyco_hydro_cat
SignalP No significant hit
TMHMM No significant hit