close all open/close all

CDS information : Madu_00240


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction39,478 / 38,243 / - [in whole cluster]
39,478 / 38,243 / - [in contig]
Locationcomplement(38243..39478) [in whole cluster]
complement(38243..39478) [in contig]
TypeCDS
Length1,236 bp (411 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)P450 oxidoreductase
Gene
Gene (GenBank)mdpU3
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
B3XWK3
PmId
[18640605] Increase in pladienolide D production rate using a Streptomyces strain overexpressing a cytochrome P450 gene. (J Biosci Bioeng. , 2008)

close this sectionSequence

selected fasta
>putative cytochrome P450 [P450 oxidoreductase]
MHIMKDSASPTEAPADFPIPRPSRCPYRPSASHVELGADGPMTKVRLYNGRTAWLVTGAA
EARAVLSDYRRVSIRPYHGNYPLLNEEFEKVVDSGYADVLFGVDPPEHTRQRQMIMPSFT
LRRTATMRADIQRIVDDRLDEMERGGGQGDLVSQFAQPVPSMVMSRLLGVPYSEHEEFET
PAHKLFVPELAEEATAELGEYLDRLIRKKEADPDGGERGLLDDLIADHLQKDALSRDELV
HIAMAMLVAGTDTTTNVISLGTLALLDTPGQWDALRDDPDLTAAAVEEILRYVSLVEAFA
RVAVEDIDLGGATIRAGEGILISCAGVNFDAAVIDTPDAFDIRRPPRPSFSFSHGIHRCP
GDNLARLELEIAFRTLVTRFPNLRATVPTPELRSNNNDGTLQRLYELPVTW
selected fasta
>putative cytochrome P450 [P450 oxidoreductase]
ATGCACATCATGAAGGACTCAGCTTCGCCGACCGAGGCGCCCGCGGACTTTCCGATCCCG
CGGCCCTCGCGGTGCCCCTACCGGCCCTCGGCCTCCCATGTCGAACTCGGCGCGGACGGT
CCGATGACGAAGGTGCGGTTGTACAACGGCCGCACGGCCTGGCTGGTGACGGGCGCGGCC
GAGGCCCGCGCCGTCCTCTCCGACTACCGCCGGGTCTCCATCCGCCCGTACCACGGCAAC
TACCCGCTGCTGAACGAGGAGTTCGAGAAGGTCGTCGACAGCGGGTACGCCGACGTGCTG
TTCGGCGTGGACCCGCCCGAGCACACCCGGCAGCGGCAGATGATCATGCCGAGCTTCACG
CTGCGCCGGACGGCGACCATGCGGGCCGACATCCAGCGCATCGTCGACGACCGGCTGGAC
GAGATGGAGCGCGGCGGCGGGCAGGGCGACCTGGTGTCGCAGTTCGCCCAGCCGGTGCCG
TCGATGGTGATGAGCCGGCTGCTCGGCGTCCCCTACTCCGAGCACGAGGAGTTCGAGACT
CCGGCCCACAAGCTGTTCGTCCCCGAACTGGCCGAGGAGGCGACCGCGGAGCTGGGCGAG
TACCTCGACCGGCTGATCCGCAAGAAGGAGGCCGACCCTGACGGCGGCGAGCGCGGCCTG
CTCGACGACCTCATCGCCGACCACCTGCAGAAGGACGCGCTCTCCCGGGACGAACTCGTC
CACATCGCGATGGCCATGCTGGTCGCGGGCACCGACACCACCACCAACGTGATCTCGCTG
GGCACGCTGGCGCTCCTCGACACCCCGGGCCAGTGGGACGCGCTGCGCGACGACCCGGAC
CTGACCGCGGCCGCCGTCGAGGAGATCCTGCGCTACGTCTCGCTGGTCGAGGCGTTCGCC
CGCGTCGCGGTCGAGGACATCGACCTCGGCGGCGCGACGATCCGCGCGGGCGAGGGCATC
CTGATCAGCTGCGCCGGGGTCAACTTCGACGCCGCCGTGATCGACACGCCCGACGCGTTC
GACATCCGCCGCCCGCCGCGTCCGAGCTTCTCGTTCAGCCACGGCATCCACCGCTGCCCG
GGGGACAACCTGGCCCGGCTGGAGCTGGAGATCGCCTTCCGGACGCTCGTCACGCGCTTC
CCGAACCTGCGCGCGACCGTGCCCACCCCCGAGCTGCGCAGCAACAACAACGACGGAACC
CTCCAGCGGCTCTACGAGCTGCCGGTGACCTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [249-266]  2.4000006166714e-07 PR00385 [284-295]  2.4000006166714e-07 PR00385 [350-359]  2.4000006166714e-07 PR00385 [359-370]  2.4000006166714e-07 PR00385
PR00385   P450
 [191-380]  3.2e-23 PF00067
PF00067   p450
 [28-411]  5.40000000000002e-98 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [15-411]  5.50001754266469e-87 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [103-114]  5.09998762524166e-45 PR00359 [150-166]  5.09998762524166e-45 PR00359 [167-182]  5.09998762524166e-45 PR00359 [200-222]  5.09998762524166e-45 PR00359 [284-295]  5.09998762524166e-45 PR00359 [301-328]  5.09998762524166e-45 PR00359 [329-344]  5.09998762524166e-45 PR00359 [350-359]  5.09998762524166e-45 PR00359 [359-370]  5.09998762524166e-45 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [352-361]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit