close all open/close all

CDS information : Madu_00250


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction40,897 / 39,512 / - [in whole cluster]
40,897 / 39,512 / - [in contig]
Locationcomplement(39512..40897) [in whole cluster]
complement(39512..40897) [in contig]
TypeCDS
Length1,386 bp (461 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative aminotransferase
Product (GenBank)aminotransferase
Gene
Gene (GenBank)mdpC7
EC number2.6.1.-
Keyword
  • (S)-3-(2-chloro-3-hydroxy-4-methoxyphenyl)-3-hydroxypropionic acid
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
B7V2L0
PmId
[12081945] Functional analysis and regulation of the divergent spuABCDEFGH-spuI operons for polyamine uptake and utilization in Pseudomonas aeruginosa PAO1. (J Bacteriol. , 2002)
Family/Domain
FD
IPR005814

close this sectionSequence

selected fasta
>putative aminotransferase [aminotransferase]
MTISSTRPVGAMSAAELEELDRRHLVHPHQRGAYPGRRVIVRGEGSTVWDAAGRELLDVT
GGGNWVAQVGHGRRELADAAAAQMTELGYFTGFFEFANDKSIRLAERLAAMVPGDLDRAF
LASGGSEAVDTAIKLARLHHHNRGETDRTWIIARQWGYHGATLGSGTATGFPQMQVGVGP
TLPHVEKVTPPMPFHTEMYGGQDPTDFLVDELARTIERIGPGNIAAMIGEPMLGGGGVVA
PPADYWPRVRALLAEHGILLIADEVITAFGRTGVWFDSARRGMDPDIVVLAKGLTSGYAP
LGAVLMREGIAESVVGGDAYLHHGHTYSGHPVSCAVALTNLDLLEKERLPERSAAIGDRL
RAGLAPALDVPAVGEIRVEGATVGIELVADPAARAPMGPEPVEAVLDELYDGHGLIVRNY
GPTLVLAPPLVLTDAETDRATAAIVDVLRRLDAENARIAPR
selected fasta
>putative aminotransferase [aminotransferase]
GTGACGATCTCATCCACCCGGCCGGTGGGCGCGATGTCCGCCGCGGAACTGGAAGAACTC
GACCGCCGCCATCTCGTGCACCCGCACCAGCGGGGCGCGTACCCGGGGCGCCGCGTCATC
GTCCGCGGCGAGGGCAGCACGGTCTGGGACGCCGCCGGGCGCGAGCTGCTCGACGTGACC
GGCGGCGGCAACTGGGTCGCCCAGGTCGGGCACGGCCGCCGCGAGCTGGCCGACGCCGCC
GCGGCGCAGATGACGGAGCTGGGCTACTTCACCGGGTTCTTCGAGTTCGCCAACGACAAG
TCGATCCGGCTTGCCGAGCGGCTGGCCGCGATGGTGCCCGGCGACCTCGACCGCGCCTTC
CTGGCCAGCGGCGGCTCGGAGGCCGTGGACACCGCCATCAAGCTGGCCCGGCTGCACCAC
CACAACCGGGGCGAGACGGACCGCACCTGGATCATCGCCCGGCAGTGGGGGTATCACGGC
GCGACCCTCGGCAGCGGCACCGCCACCGGCTTCCCGCAGATGCAGGTGGGCGTGGGGCCG
ACCCTGCCGCACGTCGAGAAGGTCACCCCGCCGATGCCGTTCCACACCGAGATGTACGGC
GGCCAGGACCCGACCGACTTCCTCGTCGACGAGCTGGCGCGGACGATCGAGCGCATCGGC
CCCGGCAACATCGCCGCGATGATCGGCGAGCCGATGCTGGGCGGCGGCGGCGTGGTCGCC
CCGCCGGCCGACTACTGGCCGCGGGTCCGCGCGCTGCTCGCCGAGCACGGCATCCTGCTG
ATCGCCGACGAGGTGATCACCGCGTTCGGCCGGACCGGTGTCTGGTTCGACTCCGCCCGG
CGCGGCATGGACCCCGACATCGTCGTCCTGGCCAAGGGCCTGACCAGCGGCTACGCGCCC
CTCGGCGCGGTGCTGATGCGGGAGGGGATCGCCGAGTCCGTGGTGGGCGGGGACGCCTAC
CTGCACCACGGGCACACCTACTCGGGCCACCCGGTGTCCTGCGCCGTGGCGCTCACGAAC
CTCGACCTGCTGGAGAAGGAGCGGCTGCCGGAGCGGTCCGCGGCGATCGGCGACCGGCTG
CGCGCCGGGCTCGCGCCGGCTCTCGACGTGCCCGCCGTCGGCGAGATCCGGGTGGAGGGC
GCGACGGTCGGCATCGAGTTGGTCGCCGACCCGGCGGCCCGCGCGCCGATGGGCCCCGAA
CCGGTCGAGGCCGTCCTCGACGAGCTGTACGACGGGCACGGCCTGATCGTCCGGAACTAC
GGGCCCACGCTCGTCCTGGCGCCGCCGCTGGTGCTCACCGACGCCGAGACGGACCGCGCC
ACCGCGGCGATCGTGGACGTCCTGCGGCGGCTGGACGCCGAGAACGCCCGGATCGCGCCG
CGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005814 Aminotransferase class-III (Family)
 [39-388]  3.30000000000002e-82 PF00202
PF00202   Aminotran_3
 [260-297]  PS00600
PS00600   AA_TRANSFER_CLASS_3
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [75-347]  3.70000000000004e-80 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [15-73]  2.4e-33 G3DSA:3.90.1150.10 [349-451]  2.4e-33 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [13-451]  1.50000965748778e-115 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit