close all open/close all

CDS information : Madu_00260


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction41,116 / 41,619 / + [in whole cluster]
41,116 / 41,619 / + [in contig]
Location41116..41619 [in whole cluster]
41116..41619 [in contig]
TypeCDS
Length504 bp (167 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productmaduropeptin apoprotein
Product (GenBank)binding protein
Gene
Gene (GenBank)mdpA
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>maduropeptin apoprotein [binding protein]
MQMPKLGRRTALLAAAATMTTGLFAAAGAAPAMADTVTVNYDCVGYPSDIAVTIDAPATA
GVGDTATFEVSSVVTTGAPQDLPAGEVVTDMAIVVGGAQSGTITASGLTNEATPAGQPVN
MVGGEAQITFTSAGSVTFTPSTTTQVDNGAQCTVVGEAPVGATTVVS
selected fasta
>maduropeptin apoprotein [binding protein]
GTGCAAATGCCCAAACTGGGCAGGCGGACCGCGCTGCTGGCGGCGGCCGCCACCATGACC
ACCGGACTGTTCGCCGCGGCGGGCGCCGCGCCCGCCATGGCGGACACCGTCACGGTCAAC
TACGACTGCGTCGGCTACCCGTCGGACATCGCCGTGACCATCGACGCGCCGGCCACGGCC
GGCGTGGGCGACACCGCCACCTTCGAGGTCAGCTCCGTGGTGACCACCGGCGCCCCGCAG
GACCTCCCCGCCGGGGAGGTCGTGACCGACATGGCGATCGTGGTGGGCGGTGCCCAGTCC
GGCACCATCACCGCGAGCGGCCTGACGAACGAGGCCACCCCCGCCGGCCAGCCCGTGAAC
ATGGTCGGCGGCGAGGCCCAGATCACGTTCACCTCGGCCGGCTCCGTCACCTTCACCCCG
TCCACCACCACCCAGGTCGACAACGGCGCGCAGTGCACCGTCGTCGGCGAGGCCCCGGTC
GGCGCCACGACGGTGGTCTCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006311 Twin-arginine translocation pathway, signal sequence (Conserved_site)
 [1-34]  PS51318
PS51318   TAT
SignalP
 [1-34]  0.67 Signal
Bacteria, Gram-positive   
 [1-34]  0.634 Signal
Eukaryota   
 [1-34]  0.812 Signal
Bacteria, Gram-negative   
TMHMM
 [12-34]  Transmembrane (i-o)
Transmembrane 1