close all open/close all

CDS information : Madu_00270


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction43,750 / 42,173 / - [in whole cluster]
43,750 / 42,173 / - [in contig]
Locationcomplement(42173..43750) [in whole cluster]
complement(42173..43750) [in contig]
TypeCDS
Length1,578 bp (525 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)transmembrane efflux protein
Gene
Gene (GenBank)mdpR3
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q939A4
PmId
[12937892] Repressed multidrug resistance genes in Streptomyces lividans. (Arch Microbiol. , 2003)

close this sectionSequence

selected fasta
>putative drug resistance transporter [transmembrane efflux protein]
MTNPAQPPKAGRREWIALAVLCLPTMLAAVDINIMFLALPHIAEDLGSGGTAQLWMTDIY
GFMIAGFLITMGSLGDRIGRRKLLMAGSAVFLVASLFAAFATSTEMLIISRAVLGVAGAT
IAPSVLGLLRQMFQDPKQMGAAMGLWGTSIMLGSVLGPVVGGLLLGAFWWGSIFIMAVPI
TGLLLLTGFFLLPESNNPNAPKLDLISVGMTLAGILPLIWGLKEAAREGWSAGSIAAVAI
GAVFLVAFVQRQRMVENPLMDLSLFRVRTLSIALLLALSIALVMGGLGLMATQFMQMILD
LSAFRVGAWMLLPAIALFIIGNMGTALARKIRPGIVLAGGALVAAVGMVVVAQVTPSSSL
ALLLIGMAIVFGGGGMIGIMSPFLVMSSAPPEKGGAAGSYSSTVGEFGTALGVAVMGLIG
TAVYRGQLTVPSGVPEEAAEVAQESISGAVFTSEAISDAQGTELLASAESAFTDSFHTVA
WIAVVLYVGVAALAAFGLKHVPATGDQPADPMGAQGVEQVPDGVS
selected fasta
>putative drug resistance transporter [transmembrane efflux protein]
ATGACGAACCCCGCCCAACCTCCCAAGGCAGGGAGGCGGGAATGGATCGCGCTGGCAGTG
CTCTGCCTGCCCACCATGTTGGCGGCCGTGGACATCAACATCATGTTCCTGGCCCTGCCG
CACATCGCCGAGGACCTGGGGTCCGGCGGAACGGCCCAGCTGTGGATGACCGACATCTAC
GGTTTCATGATCGCCGGCTTCCTCATCACCATGGGGTCCCTCGGTGACCGCATCGGGCGA
CGCAAGCTGCTGATGGCCGGGTCCGCGGTGTTCCTCGTGGCGTCGCTGTTCGCGGCCTTC
GCCACCTCGACCGAGATGCTGATCATCTCGCGCGCGGTGCTGGGCGTCGCCGGCGCCACG
ATCGCGCCGTCGGTACTGGGCCTGCTGCGGCAGATGTTCCAGGATCCGAAGCAGATGGGC
GCCGCCATGGGGCTGTGGGGCACCTCGATCATGCTCGGCTCCGTCCTCGGCCCGGTCGTC
GGCGGGCTGCTGCTCGGCGCCTTCTGGTGGGGATCGATCTTCATCATGGCGGTGCCGATC
ACGGGCCTGCTGCTGCTGACCGGCTTCTTCCTCCTGCCGGAGTCGAACAACCCGAACGCC
CCGAAGCTCGACCTGATCAGCGTCGGCATGACCCTGGCGGGCATCCTGCCGCTGATCTGG
GGGCTCAAGGAGGCGGCCCGGGAGGGTTGGAGCGCCGGTTCGATCGCCGCGGTCGCCATC
GGCGCGGTGTTCCTGGTGGCCTTCGTCCAGCGCCAGCGCATGGTCGAGAACCCGCTGATG
GACCTGAGCCTGTTCCGGGTGCGCACCCTGTCGATCGCGCTCCTGCTGGCGCTGTCGATC
GCGCTCGTCATGGGCGGCCTGGGCCTGATGGCGACGCAGTTCATGCAGATGATCCTCGAC
CTCAGCGCGTTCCGGGTGGGGGCGTGGATGCTGCTGCCGGCGATCGCGCTGTTCATCATC
GGCAACATGGGCACGGCCCTGGCCCGCAAGATCCGTCCGGGGATCGTGCTGGCCGGGGGC
GCGCTGGTCGCCGCCGTGGGCATGGTCGTCGTCGCCCAGGTGACCCCGTCGTCGTCGCTG
GCGCTGCTGCTGATCGGCATGGCGATCGTGTTCGGCGGCGGCGGGATGATCGGCATCATG
AGCCCGTTCCTGGTGATGTCGTCGGCGCCCCCCGAGAAGGGCGGCGCCGCGGGGTCGTAC
TCGTCGACCGTCGGCGAGTTCGGTACCGCGCTGGGCGTCGCGGTCATGGGCCTGATCGGC
ACCGCCGTGTACCGCGGCCAGCTCACCGTCCCGTCCGGTGTTCCGGAGGAGGCGGCCGAG
GTGGCGCAGGAGAGCATCAGCGGCGCGGTGTTCACGAGCGAGGCGATCTCCGACGCGCAG
GGCACCGAGCTGCTGGCGTCGGCCGAGAGCGCCTTCACCGACAGCTTCCACACCGTGGCG
TGGATCGCGGTGGTGCTGTACGTCGGGGTGGCCGCCCTGGCGGCCTTCGGCCTCAAGCAC
GTCCCCGCCACCGGCGACCAGCCGGCGGACCCCATGGGGGCGCAGGGCGTCGAGCAGGTG
CCCGACGGAGTGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001958 Tetracycline resistance protein, TetA/multidrug resistance protein MdtG (Family)
 [27-43]  1.6999992228405e-06 PR01035 [111-132]  1.6999992228405e-06 PR01035 [172-192]  1.6999992228405e-06 PR01035 [309-329]  1.6999992228405e-06 PR01035
PR01035   TCRTETA
IPR011701 Major facilitator superfamily (Family)
 [25-412]  4.70000000000003e-44 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-503]  9.80000272130214e-66 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [17-460]  PS50850
PS50850   MFS
SignalP No significant hit
TMHMM
 [17-39]  Transmembrane (i-o) [54-76]  Transmembrane (o-i) [83-102]  Transmembrane (i-o) [107-129]  Transmembrane (o-i) [142-164]  Transmembrane (i-o) [170-192]  Transmembrane (o-i) [205-222]  Transmembrane (i-o) [232-249]  Transmembrane (o-i) [269-291]  Transmembrane (i-o) [306-328]  Transmembrane (o-i) [335-354]  Transmembrane (i-o) [364-386]  Transmembrane (o-i) [407-424]  Transmembrane (i-o) [476-498]  Transmembrane (o-i)
Transmembrane 14