close all open/close all

CDS information : Madu_00280


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction45,205 / 43,877 / - [in whole cluster]
45,205 / 43,877 / - [in contig]
Locationcomplement(43877..45205) [in whole cluster]
complement(43877..45205) [in contig]
TypeCDS
Length1,329 bp (442 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative monooxygenase
Product (GenBank)hydroxylase
Gene
Gene (GenBank)mdpH
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
B5M9L6
NITE
Lasal_00200
PmId
[22506807] Sequential enzymatic epoxidation involved in polyether lasalocid biosynthesis. (J Am Chem Soc. , 2012)
[23796908] Biosynthetic machinery of ionophore polyether lasalocid: enzymatic construction of polyether skeleton. (Curr Opin Chem Biol. , 2013)
ACC
B5M9L6
NITE
Lasal2_00240
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)
ACC
Q846W9
NITE
Monen_00220
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)

close this sectionSequence

selected fasta
>putative monooxygenase [hydroxylase]
MYAQIGDRVIVLGGSLTGLFAAGALAESYREVVLVDRDELVGVREARRGAPQARHINGLL
AAGSRAMEDLFPEITAQMVTAGCPLTDLAGTVRWYFNGRALAQARAGLTNVAARRPIMEA
HVRERVQGFGNVVFMEGYDILGLVTSTDGTTVTGARVQSRAEGAAEEELTADLVIDATGR
GSRTPVWLEQLGYGRVEEEGTKIGLGYGTRHYRPRREVFGKDHSVVCVASADSPRGAICT
KTDDGLLELTTYGILGDHPPLDPEGFTAFVKTLAAPEIHEAIIDAEPLDDPVLFRFPTTM
RRRYERMSRFPANFLVMGDAICTPNPVFAQAQTLAALQAVALRKRVRSGVPPESGEFMRV
AGRIVDPAWELTEGINLTFPGVEGRRTGKLKFMHSYMRMLQTAATRDASITEAFMRAAGL
VDSPQSLMRPGLAWRVLRGAGA
selected fasta
>putative monooxygenase [hydroxylase]
GTGTACGCCCAAATTGGAGATCGCGTCATCGTGCTCGGCGGGAGCCTGACCGGGCTGTTC
GCCGCGGGGGCGCTCGCCGAGAGCTATCGCGAAGTCGTGCTGGTGGACCGGGACGAACTG
GTCGGCGTGCGGGAGGCGCGTCGCGGCGCGCCCCAGGCCCGCCACATCAACGGGCTCCTC
GCCGCCGGCTCGCGGGCGATGGAGGACCTGTTCCCCGAGATCACCGCGCAGATGGTCACG
GCCGGCTGCCCGCTCACCGACCTGGCGGGCACGGTCCGCTGGTACTTCAACGGACGCGCG
CTGGCGCAGGCGCGGGCCGGGCTGACCAACGTGGCCGCCCGGCGGCCGATCATGGAGGCG
CACGTCCGGGAGCGGGTCCAGGGCTTCGGGAACGTCGTCTTCATGGAGGGCTACGACATC
CTCGGCCTGGTCACGTCCACGGACGGGACCACGGTGACGGGCGCGCGGGTGCAGTCCCGG
GCCGAGGGGGCGGCCGAGGAGGAGCTGACCGCCGACCTGGTCATCGACGCCACCGGCCGC
GGCTCCCGCACGCCGGTGTGGCTGGAGCAGCTCGGGTACGGCCGGGTCGAGGAGGAGGGC
ACCAAGATCGGCCTCGGGTACGGGACGCGGCACTACCGGCCGCGCCGCGAGGTGTTCGGC
AAGGACCACTCGGTCGTCTGCGTGGCGTCGGCGGACTCCCCGCGGGGCGCGATCTGCACC
AAGACCGACGACGGCCTGCTGGAGCTGACGACGTACGGCATCCTCGGCGACCACCCGCCG
CTCGACCCGGAGGGCTTCACCGCCTTCGTCAAGACGCTGGCGGCTCCGGAGATCCACGAG
GCGATCATCGACGCCGAGCCGCTGGACGACCCGGTGCTGTTCCGCTTCCCCACCACGATG
CGCCGGCGGTACGAGCGCATGTCCCGGTTCCCGGCGAACTTCCTGGTGATGGGGGACGCC
ATCTGCACGCCCAACCCCGTGTTCGCCCAGGCGCAGACGCTGGCGGCGCTCCAGGCCGTG
GCCCTGCGCAAGCGGGTCCGCAGCGGGGTGCCGCCGGAGTCGGGCGAGTTCATGCGGGTG
GCGGGCCGCATCGTCGATCCGGCCTGGGAGCTGACCGAGGGCATCAACCTCACCTTCCCG
GGGGTCGAGGGCCGCCGCACCGGCAAGCTCAAGTTCATGCACTCCTACATGCGGATGCTG
CAGACCGCGGCGACCCGCGACGCCTCCATCACCGAGGCGTTCATGCGGGCGGCGGGCCTG
GTCGACTCGCCCCAGTCGCTGATGCGGCCGGGGCTGGCATGGAGGGTGCTGCGGGGCGCC
GGCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit