close all open/close all

CDS information : Madu_00290


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction46,939 / 45,557 / - [in whole cluster]
46,939 / 45,557 / - [in contig]
Locationcomplement(45557..46939) [in whole cluster]
complement(45557..46939) [in contig]
TypeCDS
Length1,383 bp (460 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase condensation domain protein
Product (GenBank)type II condensation domain protein
Gene
Gene (GenBank)mdpC5
EC number
Keyword
  • (S)-3-(2-chloro-3-hydroxy-4-methoxyphenyl)-3-hydroxypropionic acid
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q8GMG2
NITE
C1027_00310
PmId
[19246381] A free-standing condensation enzyme catalyzing ester bond formation in C-1027 biosynthesis. (Proc Natl Acad Sci U S A. , 2009)
[22519717] Specificity of the ester bond forming condensation enzyme SgcC5 in C-1027 biosynthesis. (Org Lett. , 2012)

close this sectionPKS/NRPS Module

C1
C24..324

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase condensation domain protein [type II condensation domain protein]
MSDVTLRSARPEPRPADPDGGAGDRIPLSLQQEFLRMVDKGDEAGPFGPQYTIVGGWRVE
GGLDVPTLRDALHDVVVRHEALRMTVVRDGDEQHQRLWPASPPDLRVRDLPADPAHRDAA
AEKFLNEVEAGLFAADERPLIRAALGRFDAGDAMLVLLAHHTLVDGWSIHVVMRDLAVCY
AARREGRAPELPPVRQYRDYVAWQRANADEPGVAISREYWRETLDGARLLPLRTDRARGS
RGSDATGWYRFLLDEEFDPALRRVAAETRSSPFMVLLAAYLLYLRERTGRTDIVLPTFMP
GRGEPWSHELVGFFYNFIPLRTDIAGCTGFRDVIARVRATCLGAYAHELPSVQFMDEAPE
LMDSVSDPRTAAVVFQVTQSPHMMYGERIGDLTYTAVRRRVVSVPVGSEIPDGVLWGLET
HPSGGMIGSIGYTTELFDEKTVAGMADDFRRVLEENLLDR
selected fasta
>non-ribosomal peptide synthetase condensation domain protein [type II condensation domain protein]
ATGTCCGACGTGACACTGAGGTCCGCGCGGCCGGAGCCGCGGCCGGCGGATCCGGACGGC
GGCGCGGGCGACCGCATCCCGCTGTCGCTCCAGCAGGAGTTCCTGCGCATGGTCGACAAG
GGGGACGAGGCGGGGCCGTTCGGCCCGCAGTACACGATCGTCGGCGGCTGGCGCGTCGAG
GGCGGGCTGGACGTGCCCACCCTGCGCGACGCGCTGCACGACGTCGTCGTCCGGCACGAG
GCGCTGCGCATGACCGTCGTCCGGGACGGCGACGAGCAGCACCAGCGGCTGTGGCCCGCG
TCCCCGCCCGACCTCCGCGTCCGCGACCTGCCGGCCGACCCCGCGCACCGCGACGCCGCC
GCCGAAAAGTTCCTCAACGAGGTCGAGGCCGGGCTGTTCGCGGCGGACGAACGGCCGCTG
ATCCGCGCCGCGCTCGGCCGCTTCGACGCGGGCGACGCGATGCTGGTGCTGCTCGCGCAC
CACACCCTGGTCGACGGGTGGTCCATCCACGTGGTCATGCGCGACCTGGCCGTCTGCTAC
GCGGCGCGCCGGGAGGGACGCGCGCCCGAGCTGCCGCCGGTGCGCCAGTACCGCGACTAC
GTGGCCTGGCAGCGGGCGAACGCGGACGAACCCGGCGTGGCGATCTCCCGCGAGTACTGG
CGGGAGACGCTGGACGGGGCCCGGCTGCTGCCGCTGCGGACCGACCGCGCCCGCGGCTCC
CGCGGCTCCGACGCCACGGGCTGGTACCGGTTCCTGCTCGACGAGGAGTTCGACCCGGCG
CTGCGGCGGGTCGCCGCCGAGACGCGCAGCTCGCCGTTCATGGTGCTCCTGGCCGCGTAC
CTGCTGTACCTGCGGGAGCGGACCGGCCGGACCGACATCGTGCTGCCGACCTTCATGCCC
GGCCGCGGGGAGCCCTGGAGCCACGAGCTCGTCGGGTTCTTCTACAACTTCATCCCGCTG
CGCACCGACATCGCCGGATGCACCGGGTTCCGGGACGTGATCGCCCGGGTCCGGGCGACC
TGCCTGGGCGCGTACGCGCACGAACTGCCGTCCGTCCAGTTCATGGACGAGGCACCCGAG
CTGATGGACTCGGTGTCGGATCCGCGCACCGCCGCCGTGGTGTTCCAGGTGACGCAGTCC
CCGCACATGATGTACGGGGAGCGCATCGGCGACCTGACCTACACCGCGGTCCGCCGCCGG
GTCGTGTCCGTACCGGTCGGGTCGGAGATCCCGGACGGCGTCCTGTGGGGGCTGGAGACG
CACCCGTCCGGCGGCATGATCGGCAGCATCGGCTACACGACCGAGCTGTTCGACGAGAAG
ACGGTGGCGGGAATGGCCGACGACTTCCGGCGAGTGCTCGAGGAGAACCTGCTCGACCGG
TGA
[1] C24..324
[1] C70..972

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001242 Condensation domain (Domain)
 [24-324]  3.09999999999998e-50 PF00668
PF00668   Condensation
SignalP No significant hit
TMHMM No significant hit