close all open/close all

CDS information : Madu_00300


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction48,513 / 46,957 / - [in whole cluster]
48,513 / 46,957 / - [in contig]
Locationcomplement(46957..48513) [in whole cluster]
complement(46957..48513) [in contig]
TypeCDS
Length1,557 bp (518 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative FADH2-dependent halogenase
Product (GenBank)halogenase
GenemdpC3
Gene (GenBank)mdpC
EC number
Keyword
  • two-component system
  • (S)-3-(2-chloro-3-hydroxy-4-methoxyphenyl)-3-hydroxypropionic acid
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
O87676
NITE
Balhi_00140
PmId
[11880037] Glycopeptide biosynthesis in Amycolatopsis mediterranei DSM5908: function of a halogenase and a haloperoxidase/perhydrolase. (Chem Biol. , 2002)
[15342578] Biosynthesis of chloro-beta-hydroxytyrosine, a nonproteinogenic amino acid of the peptidic backbone of glycopeptide antibiotics. (J Bacteriol. , 2004)
ACC
Q8GMI1
NITE
C1027_00090
PmId
[16104723] Biosynthesis of the beta-amino acid moiety of the enediyne antitumor antibiotic C-1027 featuring beta-amino acyl-S-carrier protein intermediates. (J Am Chem Soc. , 2005)
[17887753] Regiospecific chlorination of (S)-beta-tyrosyl-S-carrier protein catalyzed by SgcC3 in the biosynthesis of the enediyne antitumor antibiotic C-1027. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>putative FADH2-dependent halogenase [halogenase]
MSERTETYDRTEEYDVVVVGGGPCGSTVSTLVARQGHRVLVLEKESFPRYQIGESLLPAT
VHGICKLLGVTEELERAAFTVKRGGTFRWGANPEPWTFAFAVSSHFAGDAATAYQVERMT
FDKILLDNARRNGVEVRERVSVVDVVEEDDRVAGVRYVDTDGTRREVRARFVVDASGNKS
RIHDRVGGRRHYSEFFRNLALFGYFEGGKRMPAPNEGNILAVAFDAGWFWYIPLGPDLTS
VGAVVQPEALDRIRGDREEALRSLIADCPMIADYLSGARRVTEGPYGEIRTRKDYSYIKE
AFWKPGMVLAGDAACFIDPVFSSGVHLATYSALLAARSINTVLRGDATEADCFAEFEDRY
RREYARFHDFLVAFYDMHHDENSYFWKAKKVTRNAASDLEAFVELVGGGSSQENALVAAD
AYASDAPPSEESYSAGRHAAFRELSDIVERPVDAAGEDRDLLGSALARSVSREGTRIQVQ
AALGGNADEHVPVRPGGLVPSADGMHWSVPAAPAGTAD
selected fasta
>putative FADH2-dependent halogenase [halogenase]
GTGAGCGAGCGGACCGAGACGTACGACCGGACCGAGGAGTACGACGTCGTGGTGGTCGGC
GGCGGCCCCTGCGGCTCCACCGTGTCGACGCTCGTCGCACGGCAGGGCCACCGGGTGCTG
GTGCTGGAGAAGGAGAGCTTCCCCCGCTACCAGATCGGCGAGTCGCTGCTGCCGGCGACC
GTCCACGGCATCTGCAAGCTGCTCGGCGTGACCGAGGAGCTCGAGCGGGCGGCGTTCACC
GTCAAGCGCGGCGGGACGTTCCGCTGGGGCGCCAACCCGGAGCCGTGGACGTTCGCGTTC
GCCGTCTCGTCCCATTTCGCCGGAGACGCCGCGACCGCCTACCAGGTGGAGCGCATGACC
TTCGACAAGATCCTGCTCGACAACGCCCGCCGCAACGGCGTGGAGGTGCGGGAGCGGGTG
TCGGTGGTGGACGTCGTCGAGGAGGACGACCGCGTGGCGGGGGTCCGCTACGTCGACACC
GACGGGACCCGGCGCGAGGTGCGCGCCCGGTTCGTCGTCGACGCGTCCGGCAACAAGAGC
CGCATCCACGACAGGGTCGGCGGCCGCCGCCACTACTCGGAGTTCTTCCGCAACCTGGCC
CTGTTCGGCTACTTCGAGGGCGGCAAGCGGATGCCCGCCCCCAACGAGGGCAACATCCTC
GCGGTCGCGTTCGACGCGGGCTGGTTCTGGTACATCCCGCTCGGCCCCGACCTCACCAGC
GTCGGCGCGGTGGTGCAGCCGGAGGCGCTCGACCGGATCCGCGGCGACCGCGAGGAGGCG
CTGCGCTCGCTCATCGCGGACTGCCCGATGATCGCCGACTACCTGTCCGGCGCCCGCCGG
GTCACCGAGGGGCCGTACGGGGAGATCCGGACCCGCAAGGACTACTCCTACATCAAGGAG
GCGTTCTGGAAGCCGGGCATGGTGCTGGCGGGCGACGCCGCCTGCTTCATCGACCCGGTC
TTCTCCTCGGGCGTGCACCTGGCGACCTACAGCGCCCTGCTGGCGGCCCGGTCGATCAAC
ACCGTGCTGCGCGGCGACGCCACCGAGGCCGACTGCTTCGCGGAGTTCGAGGACCGGTAC
CGGCGGGAGTACGCGCGGTTCCACGACTTCCTCGTGGCCTTCTACGACATGCACCACGAC
GAGAACTCCTACTTCTGGAAGGCCAAGAAGGTGACCCGCAACGCCGCCTCCGACCTGGAG
GCGTTCGTCGAGCTGGTCGGCGGCGGGTCCTCCCAGGAGAACGCGCTGGTCGCGGCCGAC
GCCTACGCCTCCGACGCGCCGCCGTCCGAGGAGTCCTACTCCGCCGGGCGCCACGCCGCG
TTCCGCGAGCTGTCGGACATCGTCGAGCGTCCGGTGGACGCGGCGGGGGAGGACCGCGAC
CTGCTGGGGTCCGCGCTGGCCCGGTCGGTCTCCCGGGAGGGCACCCGGATACAGGTGCAG
GCCGCCCTCGGCGGCAACGCCGACGAGCACGTCCCGGTGCGTCCGGGAGGTCTGGTCCCG
TCCGCGGACGGCATGCACTGGAGCGTCCCGGCCGCACCCGCCGGGACGGCGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [15-37]  8.49999291746323e-10 PR00420 [168-183]  8.49999291746323e-10 PR00420 [304-319]  8.49999291746323e-10 PR00420
PR00420   RNGMNOXGNASE
IPR006905 Tryptophan halogenase (Family)
 [15-104]  7.29999999999999e-22 PF04820 [110-411]  1.09999999999999e-57 PF04820
PF04820   Trp_halogenase
SignalP No significant hit
TMHMM No significant hit