close all open/close all

CDS information : Madu_00310


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction50,251 / 48,638 / - [in whole cluster]
50,251 / 48,638 / - [in contig]
Locationcomplement(48638..50251) [in whole cluster]
complement(48638..50251) [in contig]
TypeCDS
Length1,614 bp (537 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Product4-methylideneimidazole-5-one(MIO)-dependent tyrosine aminomutase
Product (GenBank)tyrosine aminomutase
Gene
Gene (GenBank)mdpC4
EC number
Keyword
  • (S)-3-(2-chloro-3-hydroxy-4-methoxyphenyl)-3-hydroxypropionic acid
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>4-methylideneimidazole-5-one(MIO)-dependent tyrosine aminomutase [tyrosine aminomutase]
MKVTQTEIRMPVDINGEDMDIDGLRQVAEQRIPCRLTPTVLDKAAKSRAQFETLVTQDVP
VYGVTTGYGEMIYMLVDRANEVELQTNLVRSHSAGVGRPFAEDESRAIVAARLNALAKGH
SAVRPEILERLALYLNLGITPAIPEIGSLGASGDLAPLSHLACTLIGEGRILRDGAAVET
GPELRRLGIEPLELRFKEGLALINGTSAMTGLGALVVGRAFEQIRQAEICTALVIEALRG
SMGPFQPEGHDIARPHPGQIDSAANMRALLRGSGLTVEHADLRRTVQERKREEESVQRTD
IYMQKAYSLRAIPQVLGAVRDTLGRAGETVEVELNSATDNPLFFEGREIFHGANFHGQPV
AFSMDFTTIALTQLGVLSERRLNRLLNRHLNYGLPEFLVMGEPGLNSGFAGAQYPATALV
AENRTIGPASTQSIPSNGDNQDIVSMGLIGARNARRVLNNNHTILALEFLAAAQAVDVAG
RRDGLGPAGAATYELVRSMAPTLERDRYMADEIEAVADAVSRGAFLEAARSAGVELR
selected fasta
>4-methylideneimidazole-5-one(MIO)-dependent tyrosine aminomutase [tyrosine aminomutase]
GTGAAGGTGACTCAGACCGAGATTCGAATGCCGGTTGACATCAACGGCGAGGACATGGAC
ATCGACGGGCTCCGGCAGGTGGCCGAGCAGCGGATCCCGTGCCGGCTGACGCCGACGGTG
CTGGACAAGGCCGCCAAGAGCCGCGCGCAGTTCGAGACCCTCGTCACGCAGGACGTCCCC
GTCTACGGGGTCACCACCGGCTACGGCGAGATGATCTACATGCTGGTGGACCGGGCCAAC
GAGGTGGAACTGCAGACCAACCTGGTGCGCAGCCACAGCGCCGGGGTCGGCCGGCCGTTC
GCCGAGGACGAGTCGCGCGCGATCGTCGCCGCCCGGCTCAACGCGCTGGCCAAGGGCCAC
TCGGCCGTCCGGCCCGAGATCCTGGAGCGGCTCGCGCTCTACCTCAACCTGGGCATCACC
CCGGCCATCCCCGAGATCGGCTCGCTGGGCGCCAGCGGCGACCTGGCGCCCCTGTCGCAT
CTGGCGTGCACGCTCATCGGCGAGGGCCGGATCCTGCGGGACGGCGCGGCGGTGGAGACC
GGGCCGGAGCTGCGCCGGCTGGGCATCGAGCCGCTGGAGCTGCGCTTCAAGGAGGGCCTC
GCGCTGATCAACGGCACGTCCGCGATGACCGGGCTGGGGGCGCTGGTCGTCGGCCGCGCG
TTCGAGCAGATCCGGCAGGCCGAGATCTGCACCGCGCTGGTCATCGAGGCGCTGCGCGGG
TCGATGGGCCCGTTCCAGCCGGAGGGGCACGACATCGCCCGTCCGCACCCCGGGCAGATC
GACTCGGCGGCCAACATGCGCGCCCTGCTGCGCGGCAGCGGCCTGACCGTCGAGCACGCC
GACCTGCGCCGCACCGTCCAGGAGCGCAAGCGGGAGGAGGAGAGCGTCCAGCGCACCGAC
ATCTACATGCAGAAGGCGTACTCGCTGCGGGCGATCCCGCAGGTGCTCGGCGCCGTCCGC
GACACGCTCGGCAGGGCCGGCGAGACGGTCGAGGTCGAGCTGAACTCCGCCACCGACAAC
CCGCTGTTCTTCGAGGGCCGGGAGATCTTCCACGGCGCCAACTTCCACGGCCAGCCGGTC
GCGTTCTCCATGGACTTCACGACGATCGCGCTGACCCAGCTCGGCGTCCTGTCGGAGCGG
CGCCTCAACCGCCTGCTCAACCGGCACCTCAACTACGGCCTGCCGGAGTTCCTGGTCATG
GGCGAGCCCGGCCTCAACAGCGGCTTCGCGGGCGCGCAGTACCCGGCGACCGCGCTGGTC
GCCGAGAACCGGACGATCGGCCCGGCCAGCACGCAGTCCATCCCGTCCAACGGCGACAAC
CAGGACATCGTGAGCATGGGGCTGATCGGCGCCCGCAACGCGCGCCGCGTCCTGAACAAC
AACCACACGATCCTGGCCCTGGAGTTCCTCGCCGCCGCCCAGGCGGTGGACGTCGCCGGA
CGCCGCGACGGGCTCGGCCCCGCGGGCGCCGCGACGTACGAGCTCGTCCGGTCGATGGCG
CCGACCCTGGAACGCGACCGGTACATGGCCGACGAGATCGAGGCCGTGGCCGACGCGGTC
TCGCGCGGGGCCTTCCTGGAGGCGGCCCGCTCCGCGGGCGTCGAGCTGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001106 Aromatic amino acid lyase (Family)
 [12-504]  PF00221
PF00221   Lyase_aromatic
IPR008948 L-Aspartase-like (Domain)
 [11-536]  SSF48557
SSF48557   L-Aspartase-like
IPR022313 Phenylalanine/histidine ammonia-lyases, active site (Active_site)
 [147-162]  PS00488
PS00488   PAL_HISTIDASE
IPR022314 Tyrosine 2,3-aminomutase, putative (Family)
 [14-520]  TIGR03832
TIGR03832   Tyr_2_3_mutase
IPR024083 L-Aspartase-like, N-terminal (Domain)
 [4-205]  4.2e-65 G3DSA:1.10.275.10
G3DSA:1.10.275.10   G3DSA:1.10.275.10
SignalP No significant hit
TMHMM No significant hit