close all open/close all

CDS information : Madu_00320


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction53,595 / 50,248 / - [in whole cluster]
53,595 / 50,248 / - [in contig]
Locationcomplement(50248..53595) [in whole cluster]
complement(50248..53595) [in contig]
TypeCDS
Length3,348 bp (1,115 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)type II beta-Tyr adenylation domain protein
Gene
Gene (GenBank)mdpC1
EC number
Keyword
  • (S)-3-(2-chloro-3-hydroxy-4-methoxyphenyl)-3-hydroxypropionic acid
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q8GMF9
NITE
C1027_00340
PmId
[16104723] Biosynthesis of the beta-amino acid moiety of the enediyne antitumor antibiotic C-1027 featuring beta-amino acyl-S-carrier protein intermediates. (J Am Chem Soc. , 2005)
[16887797] Substrate specificity of the adenylation enzyme SgcC1 involved in the biosynthesis of the enediyne antitumor antibiotic C-1027. (J Biol Chem. , 2006)

close this sectionPKS/NRPS Module

C1 L-alpha-tyrosine
C14..284
A524..934
PCP1019..1086

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [type II beta-Tyr adenylation domain protein]
MTAIGTAPHDAGAASGVQAGFRFLDRMAPDGTAHRIRRAYEVRGPLDVPALRDAWTATLD
RHELLRTAIGEDDDGRPVPLPVADPAASFVRDGRPRHVGGAPATLTVTSRAPDSHRLLLD
LHPACADERSVAIVLAELSYRYARAVGAEPGDAPPEPRARYLDHAARSRAAEAAPAFRRS
LAWWAAALTPPPEPPDLPADGARSGVAADRASVPFTWTDGVAEPLARLCERERVRPDAVL
LAALHALLHRYGGAARTAVGVPCPVRPAGSAGVVGPFENLLVHVADSTGDPSFRELVRRT
ARTLRAAREHRAVPFDRIVRTVDVPRAPDRLPLCDVLFRYAEDEPSGLRLPGAEVRPSEA
AAPAVAALALSIEGASASRVAGTLGYRTDMFGREAAEGVLTQLRTLLAAALTAPETPADA
LPLTPPTTDTSDLTTRVEADPPDAPPSTHSAPPTLPGADPSAATDPSDAGSSALPGADLS
DLSDLSGAVPGAASGAGTVHGMVLRSAARVPGAVAVSHLGEELTYAELERESSRIAAYLR
GIGAEGAPVAIRAPAGTRRISASLGALRAGAHLVWFGPGDVGERGRQVLTELRPACLLLD
GDPEQDPLGRWYRDELGGRTVGVSAAGREPAPLPPDGPAGPATTVYVAHTSGSTGRPKGV
AHTHASFAQFLTWMADALDIGPGTRLAQWAAPEHDPSLCEVFATLAAGGTLCPVPDRIRA
HPERLVDWLVAERITFLQVIPGLARELLKELRRRGGTERLAALDRLVLMGEALPGELADA
LRDALPGARLANVYGPTETIAATWYDITGPVAGTVPIGRPIPGRQVLVLDGADRPCPTGV
TGELVIRSPYAAAGYVGGIGDEAFRPVPGLDDPPGAGGPVRCYRTGDLARRRWDGLLEFR
GRRDHQVKLSGVRLELAEIEAVLAAQDSVAECAVVPVVDGDGLVSRLVAYVVPGPDGDAG
GATEWRARLRGRFGASVRLVSFETLRGPLPRNAAGKIDRRRLPVPGPVAVPARAPKGAVE
GALADIWRRLLDVEHVDAGTSFFAAGGHSLLLARLASRIRRRFGVEIPLLECLAHPTLAG
MSALIEASGGADAGTWTHQRADVDAETGTVPERSE
selected fasta
>non-ribosomal peptide synthetase [type II beta-Tyr adenylation domain protein]
ATGACTGCGATCGGAACGGCCCCGCACGATGCCGGGGCCGCCTCCGGCGTCCAGGCCGGT
TTCCGGTTCCTGGACCGCATGGCCCCGGACGGGACGGCGCACCGGATCCGCCGCGCGTAC
GAGGTGCGCGGGCCGCTCGACGTGCCCGCCCTCCGCGACGCGTGGACGGCGACGCTGGAC
CGGCACGAACTGCTGCGCACCGCCATCGGGGAGGACGACGACGGACGGCCGGTGCCGCTG
CCGGTCGCCGACCCGGCCGCCTCGTTCGTCCGGGACGGGCGTCCCCGGCACGTCGGCGGG
GCGCCCGCCACGCTGACGGTGACGAGCCGGGCGCCGGACTCCCACCGTCTCCTGCTGGAC
CTGCACCCGGCCTGCGCCGACGAACGGTCGGTCGCGATCGTCCTGGCGGAGCTGTCGTAC
CGCTACGCCCGCGCGGTCGGAGCCGAGCCGGGCGACGCGCCGCCGGAACCCCGCGCCCGG
TACCTCGACCACGCCGCCCGGAGCCGCGCGGCCGAGGCCGCGCCCGCGTTCCGGCGCTCG
CTGGCCTGGTGGGCGGCGGCGCTGACACCGCCGCCCGAACCCCCGGACCTGCCCGCCGAC
GGGGCCCGCTCGGGCGTCGCCGCGGACCGCGCGTCCGTGCCGTTCACCTGGACGGACGGC
GTCGCGGAGCCGCTCGCGCGGCTGTGCGAACGCGAGCGGGTGCGGCCCGACGCCGTGCTG
CTCGCGGCCCTGCACGCCCTGCTCCACCGGTACGGCGGCGCGGCGCGGACGGCGGTCGGC
GTCCCGTGCCCGGTGCGCCCGGCCGGATCCGCCGGCGTCGTCGGCCCCTTCGAGAACCTG
CTGGTCCACGTCGCGGACTCCACCGGGGACCCGTCCTTCCGCGAGCTGGTCCGGCGGACG
GCGCGCACCCTGCGGGCGGCCCGCGAGCACCGCGCGGTGCCGTTCGACCGGATCGTCCGG
ACCGTGGACGTTCCGCGCGCCCCGGACCGCCTCCCCCTGTGCGACGTCCTGTTCCGGTAC
GCGGAGGACGAGCCGTCCGGGCTCCGGCTCCCCGGTGCCGAGGTGCGCCCGTCCGAGGCC
GCCGCCCCGGCCGTCGCCGCACTCGCCCTGAGCATCGAGGGCGCCTCCGCGTCGCGCGTG
GCGGGCACCCTCGGATACCGGACCGACATGTTCGGGCGCGAGGCCGCGGAGGGCGTCCTC
ACCCAGCTCCGCACGCTACTGGCCGCCGCGCTCACCGCCCCCGAAACCCCCGCGGACGCC
CTCCCCCTGACCCCACCGACCACGGACACGTCGGACCTGACCACGCGGGTGGAGGCGGAC
CCGCCGGACGCGCCCCCTTCGACCCACTCGGCCCCCCCGACCCTGCCGGGCGCGGACCCG
TCGGCTGCGACGGATCCGTCGGACGCGGGCTCCTCGGCCCTGCCGGGCGCGGACCTGTCG
GACCTGTCGGACCTGTCGGGCGCGGTGCCCGGCGCAGCGTCCGGTGCGGGGACCGTGCAC
GGGATGGTGTTGCGGAGTGCGGCGCGTGTGCCCGGGGCCGTCGCCGTCTCCCATCTCGGC
GAGGAGCTGACCTACGCGGAGCTGGAGCGCGAGTCGTCCCGGATCGCCGCGTACCTGCGC
GGCATCGGGGCGGAGGGCGCGCCCGTGGCGATCCGGGCGCCCGCCGGGACGCGCCGGATC
TCGGCGTCGCTCGGTGCGCTGCGCGCCGGGGCGCACCTGGTCTGGTTCGGTCCCGGGGAC
GTGGGGGAGCGGGGGCGGCAGGTCCTCACCGAGCTGCGTCCGGCATGCCTCCTGCTGGAC
GGCGACCCGGAGCAGGACCCGCTCGGCCGCTGGTACCGCGACGAGCTGGGCGGCCGGACG
GTCGGCGTGTCCGCCGCGGGCCGCGAACCGGCCCCGCTCCCCCCGGACGGCCCCGCGGGG
CCCGCCACCACGGTGTACGTCGCCCACACCTCGGGTTCGACGGGACGCCCGAAGGGCGTC
GCCCACACGCACGCGTCGTTCGCCCAGTTCCTCACCTGGATGGCGGACGCGCTCGACATC
GGGCCCGGCACGCGGCTGGCGCAGTGGGCGGCCCCCGAGCACGACCCGAGCCTGTGCGAG
GTGTTCGCGACGCTCGCCGCGGGCGGGACGCTGTGCCCGGTGCCGGACCGGATCCGGGCC
CACCCCGAACGCCTCGTCGACTGGCTGGTCGCGGAGCGGATCACGTTCCTCCAGGTCATC
CCCGGTCTCGCCCGGGAGCTGCTGAAGGAGCTGCGGCGGCGCGGCGGGACGGAGCGGCTC
GCGGCGCTGGACCGCCTGGTGCTCATGGGCGAGGCGCTGCCCGGCGAGCTGGCCGACGCG
CTGCGCGACGCGCTGCCCGGCGCCCGGCTCGCCAACGTCTACGGCCCCACCGAGACGATC
GCGGCGACCTGGTACGACATCACGGGACCGGTCGCGGGCACGGTGCCGATCGGGCGGCCG
ATCCCCGGCCGTCAGGTCCTGGTGCTGGACGGCGCGGACCGGCCGTGCCCCACCGGAGTG
ACCGGCGAACTCGTCATCCGCAGCCCGTACGCCGCCGCCGGATACGTCGGCGGGATCGGT
GACGAGGCGTTCCGTCCGGTGCCCGGCCTGGACGACCCGCCCGGTGCGGGCGGTCCCGTG
CGCTGCTACCGCACCGGCGACCTCGCGCGCCGCCGCTGGGACGGCCTGCTGGAGTTCCGG
GGGCGGCGCGACCACCAGGTCAAGCTGTCCGGCGTCCGGCTGGAGCTCGCCGAGATCGAG
GCCGTGCTCGCCGCGCAGGACTCGGTCGCCGAGTGCGCGGTCGTCCCGGTCGTCGACGGG
GACGGCCTGGTGAGCCGGCTCGTCGCCTACGTCGTGCCCGGCCCGGACGGGGACGCGGGC
GGGGCGACCGAATGGCGGGCCCGGCTGCGCGGCCGCTTCGGCGCGTCGGTGCGGCTGGTG
TCCTTCGAGACCCTCCGGGGCCCGCTGCCGCGCAACGCCGCGGGCAAGATCGACCGGCGC
CGGCTGCCCGTGCCCGGACCGGTCGCCGTCCCGGCACGGGCGCCCAAGGGAGCCGTCGAG
GGAGCCCTGGCCGACATCTGGCGGCGGCTGCTGGACGTCGAGCACGTCGACGCCGGCACG
TCGTTCTTCGCGGCGGGTGGCCACTCGCTGCTGCTAGCCCGGCTCGCCAGCCGGATCCGA
AGGCGCTTCGGGGTGGAGATCCCGCTCCTCGAGTGCCTCGCACACCCCACGTTGGCCGGA
ATGTCCGCGCTGATCGAGGCATCGGGCGGAGCGGACGCCGGGACGTGGACACACCAGCGG
GCAGACGTCGACGCCGAGACCGGCACTGTCCCCGAGCGATCGGAGTGA
[1] C14..284
[1] A524..934
[1] L-alpha-tyrosine695..801
[1] PCP1019..1086
[1] C40..852
[1] A1570..2802
[1] L-alpha-tyrosine2083..2403
[1] PCP3055..3258

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [524-934]  1.20000000000001e-79 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [14-79]  1e-08 PF00668 [104-284]  3.90000000000001e-20 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [1044-1059]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1019-1086]  PS50075
PS50075   ACP_DOMAIN
 [1023-1085]  6.50000000000001e-14 PF00550
PF00550   PP-binding
 [1012-1087]  6.50000805230168e-18 SSF47336
SSF47336   ACP_like
 [1011-1089]  9e-24 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR020845 AMP-binding, conserved site (Conserved_site)
 [647-658]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit