close all open/close all

CDS information : Madu_00330


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction53,809 / 54,096 / + [in whole cluster]
53,809 / 54,096 / + [in contig]
Location53809..54096 [in whole cluster]
53809..54096 [in contig]
TypeCDS
Length288 bp (95 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase peptidyl carrier protein
Product (GenBank)type II PCP domain protein
Gene
Gene (GenBank)mdpC2
EC number
Keyword
  • (S)-3-(2-chloro-3-hydroxy-4-methoxyphenyl)-3-hydroxypropionic acid
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q8GMG1
NITE
C1027_00320
PmId
[16104723] Biosynthesis of the beta-amino acid moiety of the enediyne antitumor antibiotic C-1027 featuring beta-amino acyl-S-carrier protein intermediates. (J Am Chem Soc. , 2005)

close this sectionPKS/NRPS Module

C1
PCP14..81

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase peptidyl carrier protein [type II PCP domain protein]
MPERDSHDSSTALIEKRVAEIWQDVLGMPDGTCDGTFFQLRGQSISAVRITGRIEDDLGI
VVDVGVLFEDPDLAAFTREVLAARGAEGVAAGAGD
selected fasta
>non-ribosomal peptide synthetase peptidyl carrier protein [type II PCP domain protein]
ATGCCCGAAAGAGACTCACACGATTCGTCGACGGCGCTGATCGAAAAGCGCGTGGCGGAA
ATCTGGCAGGACGTTCTCGGCATGCCGGACGGCACCTGCGATGGCACTTTCTTCCAGTTG
CGCGGGCAATCGATCTCGGCGGTCCGCATCACCGGCCGCATCGAGGACGACCTGGGCATC
GTGGTGGACGTGGGCGTGCTGTTCGAGGACCCCGATCTGGCCGCGTTCACCCGGGAGGTC
CTCGCGGCCCGCGGTGCCGAGGGCGTCGCGGCCGGCGCGGGCGACTGA
[1] PCP14..81
[1] PCP40..243

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [8-84]  1.2e-16 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [7-82]  2.79999889404114e-11 SSF47336
SSF47336   ACP_like
 [17-80]  6.2e-12 PF00550
PF00550   PP-binding
 [14-81]  PS50075
PS50075   ACP_DOMAIN
SignalP No significant hit
TMHMM No significant hit