close all open/close all

CDS information : Madu_00340


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction54,756 / 54,160 / - [in whole cluster]
54,756 / 54,160 / - [in contig]
Locationcomplement(54160..54756) [in whole cluster]
complement(54160..54756) [in contig]
TypeCDS
Length597 bp (198 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative O-methyltransferase
Product (GenBank)O-methyltransferase
Gene
Gene (GenBank)mdpC6
EC number2.1.1.-
Keyword
  • (S)-3-(2-chloro-3-hydroxy-4-methoxyphenyl)-3-hydroxypropionic acid
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q8KUG5
NITE
Ansam_00190
PmId
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
ACC
P28034
PmId
[1894629] Molecular cloning, induction and taxonomic distribution of caffeoyl-CoA 3-O-methyltransferase, an enzyme involved in disease resistance. (J Biol Chem. , 1991)
[9037150] Structure of the parsley caffeoyl-CoA O-methyltransferase gene, harbouring a novel elicitor responsive cis-acting element. (Plant Mol Biol. , 1997)

close this sectionSequence

selected fasta
>putative O-methyltransferase [O-methyltransferase]
MVRDLAARTAEVGDAAGMMVPVEQAALLTLLTRLVSAAVVVDVGTFTGLSALAFARGLAP
GGTVVTCDVTDEWLGVAREHWRRAGVADRIEFRLGAAARTLTDLAAGPAADLVFLDADKM
NYPRYLGLAVPLLRPGGLLVADNVLLDGSVLDPARAPAGLPRRAAERMREFNAALAADDR
LEAVMLPIADGMTVARKR
selected fasta
>putative O-methyltransferase [O-methyltransferase]
GTGGTGCGCGACCTGGCCGCGCGCACGGCCGAGGTCGGCGACGCCGCGGGCATGATGGTG
CCGGTCGAGCAGGCCGCCCTGCTCACCCTGCTGACCAGGCTGGTGTCCGCCGCCGTGGTC
GTGGACGTGGGGACCTTCACCGGACTGTCGGCCCTGGCCTTCGCCCGCGGCCTGGCGCCC
GGCGGCACCGTCGTCACCTGCGACGTGACCGACGAGTGGCTGGGCGTCGCGCGCGAGCAC
TGGCGGCGCGCCGGGGTCGCCGATCGCATCGAGTTCCGGCTCGGCGCGGCGGCGCGGACG
CTGACCGACCTCGCCGCCGGCCCGGCGGCCGACCTGGTCTTCCTCGACGCCGACAAGATG
AACTACCCCCGCTACCTCGGGCTGGCGGTGCCGCTGCTGCGGCCGGGCGGGCTGCTGGTG
GCCGACAACGTCCTGCTGGACGGCTCGGTCCTCGACCCCGCGCGGGCACCCGCCGGGCTG
CCGCGCCGCGCGGCGGAGCGGATGCGCGAGTTCAACGCCGCGCTCGCCGCGGACGACCGG
CTGGAGGCCGTCATGCTGCCCATCGCGGACGGGATGACGGTCGCCCGGAAACGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002935 O-methyltransferase, family 3 (Family)
 [2-198]  1.9e-54 PF01596
PF01596   Methyltransf_3
SignalP No significant hit
TMHMM No significant hit