close all open/close all

CDS information : Madu_00360


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction56,839 / 55,742 / - [in whole cluster]
56,839 / 55,742 / - [in contig]
Locationcomplement(55742..56839) [in whole cluster]
complement(55742..56839) [in contig]
TypeCDS
Length1,098 bp (365 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)mdpM
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MTGIPARAARTRAQGQIRYVTPVPYAAARGTVARVYAQVERDFGLLAPPVALHAAVPEVL
AAAWTMLRETLVASGAADRTTKEAVATAVSLANTCPYCVEVHGVTMRGLAADDAAGLIAA
DRIGEIADPGLRAVAEWARRTGTPEAGAPPSGSPAGELVGVAVTFQYLNRMVNVFLPDSP
LPANLPDPARGAARRLAARIMRSGARTHRAPGGSAGLLPPAPPPDDLAWAAGAPDVADAF
ARAAAAVEEAGRRWLPGPVRDVVSAALDEWDGRPPGPSRAWTGPLVRDLPESARPAARLA
LLTAMASYQVDAPVVDAYRRAEPVRDGSRDGSRDAALIALTAWAAFAAARRTGARSARRE
KPAGT
selected fasta
>hypothetical protein [unknown]
ATGACCGGTATCCCGGCCCGGGCGGCGCGGACACGCGCGCAGGGGCAGATCCGATACGTC
ACCCCCGTGCCGTACGCGGCGGCACGGGGGACGGTGGCTCGGGTCTACGCGCAGGTCGAA
CGCGACTTCGGCCTGCTGGCGCCGCCCGTGGCCCTGCACGCCGCGGTCCCGGAGGTGCTC
GCGGCGGCCTGGACGATGCTGCGGGAGACCCTCGTCGCCTCGGGGGCGGCCGACCGGACG
ACCAAGGAGGCCGTCGCCACCGCCGTCTCCCTCGCCAACACCTGCCCGTACTGCGTCGAG
GTGCACGGGGTGACCATGCGGGGCCTGGCGGCGGACGACGCCGCCGGCCTGATCGCCGCG
GACCGGATCGGGGAGATCGCCGATCCGGGGCTGCGGGCGGTCGCCGAGTGGGCGCGCCGG
ACCGGGACGCCGGAGGCCGGTGCGCCGCCGTCCGGGTCCCCGGCGGGGGAGCTCGTCGGC
GTGGCCGTCACCTTCCAGTACCTCAACCGCATGGTGAACGTGTTCCTCCCGGACTCGCCG
CTGCCCGCGAACCTGCCGGACCCCGCGCGCGGGGCCGCCCGGCGGCTGGCGGCCCGGATC
ATGCGGTCGGGGGCCCGCACTCACCGGGCCCCCGGCGGGTCCGCCGGCCTGCTGCCGCCC
GCACCGCCGCCGGACGACCTGGCGTGGGCGGCCGGTGCGCCGGACGTCGCGGACGCCTTC
GCGCGGGCCGCCGCCGCGGTCGAGGAGGCGGGCCGCCGGTGGCTGCCGGGCCCCGTGCGG
GACGTCGTGTCGGCCGCCCTGGACGAGTGGGACGGGCGTCCGCCGGGGCCGAGCCGGGCG
TGGACCGGCCCGCTCGTCCGGGACCTGCCGGAGTCCGCGCGTCCGGCGGCCCGGCTCGCG
CTGCTGACGGCGATGGCCTCCTACCAGGTGGACGCGCCGGTCGTCGACGCCTACCGGCGG
GCCGAGCCGGTGCGGGACGGGTCGCGGGACGGGTCGCGGGACGCGGCGCTGATCGCCCTG
ACCGCGTGGGCGGCGTTCGCGGCCGCCCGCCGGACGGGCGCCCGGTCGGCACGCCGGGAG
AAGCCCGCCGGGACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003779 Carboxymuconolactone decarboxylase (Domain)
 [60-138]  1.2e-08 PF02627
PF02627   CMD
IPR004675 Alkylhydroperoxidase AhpD core (Domain)
 [75-103]  2.7e-08 TIGR00778
TIGR00778   AhpD_dom
SignalP No significant hit
TMHMM No significant hit