close all open/close all

CDS information : Madu_00370


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction58,511 / 56,853 / - [in whole cluster]
58,511 / 56,853 / - [in contig]
Locationcomplement(56853..58511) [in whole cluster]
complement(56853..58511) [in contig]
TypeCDS
Length1,659 bp (552 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)oxidoreductase
Gene
Gene (GenBank)mdpE9
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
P12676
PmId
[2914858] Nucleotide sequence of the gene for cholesterol oxidase from a Streptomyces sp. (J Bacteriol. , 1989)
[10194345] Crystal structure determination of cholesterol oxidase from Streptomyces and structural characterization of key active site mutants. (Biochemistry. , 1999)
Family/Domain
FD
IPR000172, IPR007867

close this sectionSequence

selected fasta
>putative oxidoreductase [oxidoreductase]
MTATESTDVLIIGSGFGGAIAAYHLAAGGADVVVLERGPWLEGDDFEHDFKLGSSYTRIF
DFVVGDGMSVLGGNCVGGGSVVYFAAMPRAPRFIFERRGGIGRRMWPESVSRDALEPWYD
RVEEALPVVKQSWDEVTYAGGLWAAACDHAGRTANPVPVAVDNSKCVNCNWMMAGCKFDA
KRSLLFNYLPAAVAEGAEIRPLHEVQRLTRNAGGGYRVHYNVIDGEDYRVHTGNGTIDAK
IVVLAAGSAATPVILQRSEDDLGRMPHAVGRYFSGNGERLNTAVVNEDKVREVLGLSRPD
GRAYAANQIGRGPVVASWDRLDGSLPEYSRFSLEQLYFPPGLGTILAQVPDAAGPTWFGA
EKKEMLRNWQSWLTIFTISEDDNEGVFGPPPATGNAMRISQQMLGRGNLHYRPTLNTMRG
WAESDAAVRDILERDGLAEVRPWTNDLVGAYTVHPLASCRIGDDPATSALDDRHELRGHP
GIFVTDGSAVPCGLTVNPAMTIAALAERAMPAIVRAARDRGVEVGYGAPAPDGSTAGRRA
TLPLAPAVGGDR
selected fasta
>putative oxidoreductase [oxidoreductase]
ATGACCGCAACGGAGAGCACCGACGTCCTGATCATCGGCAGCGGGTTCGGCGGCGCGATC
GCCGCCTACCACCTGGCCGCCGGCGGTGCCGACGTCGTCGTGCTGGAACGCGGCCCGTGG
CTGGAGGGCGACGACTTCGAGCACGACTTCAAGCTCGGCTCGTCCTACACCCGGATCTTC
GACTTCGTCGTCGGCGACGGCATGAGCGTGCTCGGCGGCAACTGCGTCGGGGGCGGCAGC
GTCGTGTACTTCGCGGCGATGCCGCGCGCGCCGCGGTTCATCTTCGAGCGGCGCGGCGGC
ATCGGCCGCCGGATGTGGCCGGAGAGCGTCTCCAGGGACGCGCTGGAACCGTGGTACGAC
CGGGTGGAGGAGGCGCTGCCGGTCGTCAAGCAGTCCTGGGACGAGGTCACCTACGCGGGC
GGGCTCTGGGCGGCGGCGTGCGACCACGCGGGCCGCACCGCGAACCCCGTGCCGGTCGCC
GTGGACAACTCCAAGTGCGTCAACTGCAACTGGATGATGGCCGGGTGCAAGTTCGACGCC
AAGCGGTCGCTGCTGTTCAACTACCTGCCCGCGGCCGTGGCGGAGGGCGCCGAGATCCGG
CCGCTGCACGAGGTCCAGCGGCTCACCCGCAACGCCGGCGGCGGCTACCGCGTCCACTAC
AACGTCATCGACGGCGAGGACTACCGGGTGCACACCGGGAACGGGACCATCGACGCCAAG
ATCGTGGTCCTGGCCGCCGGCAGCGCGGCGACGCCGGTGATCCTCCAGCGCTCCGAGGAC
GACCTCGGGCGGATGCCGCACGCGGTGGGCCGCTACTTCTCCGGCAACGGCGAGCGGCTG
AACACCGCGGTCGTCAACGAGGACAAGGTGCGGGAGGTGCTCGGCCTGTCGCGCCCCGAC
GGCCGCGCCTACGCCGCCAACCAGATCGGCCGCGGGCCGGTCGTGGCGAGCTGGGACCGG
CTCGACGGAAGCCTGCCCGAGTACTCGCGCTTCTCGCTGGAGCAGCTCTACTTCCCGCCC
GGCCTGGGCACCATCCTCGCCCAGGTCCCGGACGCCGCCGGGCCCACCTGGTTCGGCGCG
GAGAAGAAGGAGATGCTGCGGAACTGGCAGTCGTGGCTGACCATCTTCACCATCTCCGAG
GACGACAACGAGGGGGTCTTCGGGCCGCCGCCGGCGACCGGCAACGCCATGCGCATCTCG
CAGCAGATGCTCGGCCGCGGCAACCTGCACTACCGGCCGACGCTGAACACCATGCGCGGG
TGGGCCGAGTCCGACGCCGCCGTCCGGGACATCCTCGAACGCGACGGGCTGGCCGAGGTG
CGGCCGTGGACGAACGACCTGGTCGGCGCGTACACCGTGCATCCGCTCGCGTCCTGCCGG
ATCGGCGACGACCCCGCGACCTCGGCGCTGGACGACCGGCACGAGCTGCGGGGGCACCCC
GGGATCTTCGTCACCGACGGCTCGGCGGTGCCCTGCGGCCTGACCGTCAACCCGGCGATG
ACCATCGCCGCGCTGGCGGAGCGGGCCATGCCCGCGATCGTGCGCGCGGCGCGGGACCGG
GGCGTCGAGGTCGGGTACGGGGCGCCCGCGCCCGACGGCTCGACGGCCGGCCGCCGGGCC
ACGCTGCCGCTGGCGCCCGCGGTGGGCGGGGACCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000172 Glucose-methanol-choline oxidoreductase, N-terminal (Domain)
 [8-258]  3.2e-15 PF00732
PF00732   GMC_oxred_N
IPR007867 Glucose-methanol-choline oxidoreductase, C-terminal (Domain)
 [447-509]  2.7e-14 PF05199
PF05199   GMC_oxred_C
SignalP No significant hit
TMHMM No significant hit