close all open/close all

CDS information : Madu_00380


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction59,077 / 58,508 / - [in whole cluster]
59,077 / 58,508 / - [in contig]
Locationcomplement(58508..59077) [in whole cluster]
complement(58508..59077) [in contig]
TypeCDS
Length570 bp (189 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)mdpE8
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MGTAAVEDERARRMTLEAFADTMIPGERRFPGDRTVAGAAPGPGAVAAGAVELLETPAAG
IVHDLPELVAMLDEHARGHAGRQGLALDPDVPAFVALPFAERTALAQALLAPGHPENEAW
ILVALFCVMAFDTGAHLHTLDAIAQGHPGLAHMGLESPDSDGLWRFPTYSYGRRLADIHP
DTTSSGSPR
selected fasta
>hypothetical protein [unknown]
GTGGGTACGGCTGCTGTGGAGGACGAGCGCGCCAGGAGAATGACCCTCGAGGCCTTCGCC
GACACCATGATCCCCGGAGAGCGGCGGTTCCCCGGGGACAGGACGGTGGCGGGCGCCGCA
CCGGGCCCCGGCGCGGTCGCCGCGGGCGCGGTGGAACTGCTGGAGACGCCGGCGGCCGGC
ATCGTCCACGACCTGCCCGAGCTGGTCGCGATGCTGGACGAGCACGCGCGCGGCCACGCC
GGGCGGCAGGGCCTGGCCCTGGACCCGGACGTGCCCGCGTTCGTCGCCCTGCCGTTCGCC
GAACGGACCGCGCTGGCGCAGGCGCTGCTGGCCCCCGGCCATCCGGAGAACGAGGCGTGG
ATCCTGGTCGCGCTGTTCTGCGTCATGGCCTTCGACACCGGCGCGCACCTGCACACGCTG
GACGCGATCGCCCAGGGGCATCCCGGCCTGGCCCACATGGGGCTGGAGAGTCCCGACTCC
GACGGGTTGTGGCGTTTCCCCACCTATTCCTACGGCCGCCGCCTGGCCGACATACACCCG
GACACGACCTCCTCGGGGAGCCCGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit