close all open/close all

CDS information : Madu_00390


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction59,561 / 60,574 / + [in whole cluster]
59,561 / 60,574 / + [in contig]
Location59561..60574 [in whole cluster]
59561..60574 [in contig]
TypeCDS
Length1,014 bp (337 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)regulatory protein
Gene
Gene (GenBank)mdpR1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q8GI86
PmId
[12617515] kasT gene of Streptomyces kasugaensis M338-M1 encodes a DNA-binding protein which binds to intergenic region of kasU-kasJ in the kasugamycin biosynthesis gene cluster. (J Antibiot (Tokyo). , 2002)
ACC
Q8GME5
NITE
C1027_00480
PmId
[19159491] Role of sgcR3 in positive regulation of enediyne antibiotic C-1027 production of Streptomyces globisporus C-1027. (BMC Microbiol. , 2009)
[20551990] Manipulation of pathway regulation in Streptomyces globisporus for overproduction of the enediyne antitumor antibiotic C-1027. (J Antibiot (Tokyo). , 2010)
[21250756] Improvement of the enediyne antitumor antibiotic C-1027 production by manipulating its biosynthetic pathway regulation in Streptomyces globisporus. (J Nat Prod. , 2011)

close this sectionSequence

selected fasta
>putative transcriptional regulator [regulatory protein]
MMSDTEPPREAPPTDTGETGTESNSPALPPVNTVLVDELLPGISPRRAEDPEHIHRLAQT
DSKLPPILVHYPSMRVIDGMHRLKAALLQGKREIDVIFFDGSDDSAFLRAVQENIAHGLP
LSLAERKAAALRIIDTWNDLSDRAIAANTGLSTRTVAQLRKRSTDESPHLNKRRGLDGRM
RPLDHHEGRRRAAEAMTRWPDASLREIARIADVSLGTAHDVRRRLHRGEDPVPSGARPAT
PPVRTVRNDGDLRTPPAEDPILMLQKLARDPALRQTEPGRQLLRLLHSRMATPRDWSALI
VSVPPHCAETAAAVARHCARNWEQMAQLLERRAESPP
selected fasta
>putative transcriptional regulator [regulatory protein]
ATGATGAGTGACACGGAACCCCCCCGAGAGGCACCCCCGACGGACACCGGCGAGACGGGA
ACCGAATCGAATTCGCCTGCTCTGCCGCCCGTTAATACCGTACTCGTCGACGAACTCCTG
CCCGGAATCTCGCCACGGCGCGCCGAGGACCCGGAACACATACATCGGCTCGCCCAAACC
GACTCGAAGCTTCCACCCATCCTGGTCCATTACCCGAGTATGCGCGTCATCGACGGCATG
CATCGCCTGAAGGCCGCCCTTTTACAGGGTAAGCGCGAGATCGACGTGATTTTTTTCGAC
GGCAGCGACGACAGCGCCTTCCTCCGGGCCGTGCAGGAGAACATCGCGCACGGGCTGCCG
TTGTCGCTCGCCGAGCGCAAGGCCGCGGCGCTGCGCATCATCGACACCTGGAACGACCTT
TCGGACCGCGCGATCGCCGCCAACACCGGGCTGTCCACGCGGACCGTCGCCCAGTTGCGG
AAGCGCTCGACCGACGAATCGCCGCACTTGAACAAACGCCGGGGGCTGGACGGCCGCATG
CGGCCACTGGACCATCACGAGGGTCGGCGGCGGGCGGCGGAGGCGATGACCCGGTGGCCC
GACGCCTCGCTCCGGGAGATCGCCAGGATCGCCGACGTCTCGCTGGGCACGGCGCACGAC
GTCCGCCGGCGGCTGCACCGCGGGGAGGACCCGGTGCCGTCCGGCGCCCGGCCCGCGACA
CCCCCCGTCAGGACCGTCCGCAACGATGGCGACCTGCGCACTCCTCCCGCCGAGGACCCC
ATCCTCATGCTCCAGAAGCTCGCCCGGGACCCGGCGCTGCGGCAGACCGAGCCCGGACGC
CAGCTGCTGCGGCTCCTGCACTCGCGCATGGCGACCCCCCGGGACTGGAGCGCCCTCATC
GTCTCGGTCCCCCCGCACTGCGCGGAGACGGCCGCCGCCGTCGCCCGGCACTGCGCCCGC
AACTGGGAGCAGATGGCGCAATTGCTGGAGCGCCGCGCAGAGTCACCGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003115 ParB-like nuclease (Domain)
 [31-117]  1.59999889349252e-11 SSF110849
SSF110849   ParBc
 [32-115]  1.20000117458134e-09 SM00470
SM00470   ParB
 [61-115]  4.1e-09 PF02195
PF02195   ParBc
SignalP No significant hit
TMHMM No significant hit