close all open/close all

CDS information : Madu_00410


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction63,069 / 61,675 / - [in whole cluster]
63,069 / 61,675 / - [in contig]
Locationcomplement(61675..63069) [in whole cluster]
complement(61675..63069) [in contig]
TypeCDS
Length1,395 bp (464 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)putative P450 hydroxylase
Gene
Gene (GenBank)mdpE7
EC number
Keyword
Note
Note (GenBank)
  • MadE7
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
O23365
PmId
[19939422] Over-expression of Arabidopsis thaliana carotenoid hydroxylases individually and in combination with a beta-carotene ketolase provides insight into in vivo functions. (Phytochemistry. , 2010)
Family/Domain
FD
IPR001128

close this sectionSequence

selected fasta
>putative cytochrome P450 [putative P450 hydroxylase]
MSIDELDARGGTPRAAGRVPPGPPRRATPNLLRMLATDRLGMMQAALRHGDAVRVGLGPK
ALYLFNRPEHAKHVLADNSGNYHKGIGLVQARRALGDGLLTSEGDLWREQRRVVQPAFQH
KRIAGLADAVVEEAGALVARLRARAGGPPVDVVGEMTALTLGVLGRTLLDADLTAHTSLG
RAFETVQDQAMFEMVSQGMVPMWLPLPGQLRFRRARRELDRIVRALVAERLREGGGAEDA
LSRLIESARREPDGRVGRRRLRDELVTLLLAGHETTASTLGWTFHLLDRHPLVRARVRAE
ARAVFGDGTPTLDDLSALSYTTMVVQEVMRMYPPVWILTRVAQRDDEVGGYRVPAGADVL
VCPYTLHRNPDFWEWPDVFDPDRFGPGRSEGRPRYAYIPFGAGPRFCVGNHLGMMEAVFV
TAMVARDLRLTGVPGRDAVPEPMLSLRVRGGLPMTVHDDAGAGA
selected fasta
>putative cytochrome P450 [putative P450 hydroxylase]
GTGAGCATCGACGAGCTGGACGCCCGCGGCGGGACGCCGCGGGCCGCCGGCCGGGTCCCG
CCGGGACCGCCCCGCCGCGCGACGCCGAACCTGCTGCGGATGCTGGCGACCGACCGGCTC
GGCATGATGCAGGCGGCCCTCCGGCACGGCGACGCCGTCCGGGTCGGGCTCGGGCCCAAG
GCCCTGTACCTGTTCAACCGTCCCGAGCACGCCAAGCACGTCCTGGCGGACAACAGCGGG
AACTACCACAAGGGCATCGGCCTGGTGCAGGCCCGGCGCGCCCTCGGTGACGGGCTCCTG
ACCAGCGAGGGCGACCTGTGGCGCGAGCAGCGCAGGGTCGTCCAGCCCGCGTTCCAGCAC
AAGCGGATCGCCGGGCTGGCCGACGCGGTCGTCGAGGAGGCGGGCGCGCTGGTCGCCCGG
CTCCGGGCCCGCGCGGGCGGCCCCCCGGTCGACGTGGTGGGGGAGATGACCGCGCTGACC
CTCGGGGTGCTCGGACGCACTCTGCTGGACGCCGACCTGACCGCGCACACCTCCCTGGGA
CGGGCGTTCGAGACCGTCCAGGACCAGGCGATGTTCGAGATGGTGAGCCAGGGCATGGTT
CCGATGTGGCTCCCGCTGCCCGGCCAGCTCCGCTTCCGCCGGGCCCGCCGGGAGCTGGAC
CGCATCGTCCGCGCCCTGGTGGCCGAGCGCCTCCGCGAGGGCGGCGGCGCCGAGGACGCG
CTGTCCCGGCTGATCGAGTCGGCGCGGCGGGAACCGGACGGCCGGGTCGGGCGGCGGCGG
CTGCGCGACGAACTCGTCACGCTGCTGCTGGCCGGGCACGAGACGACCGCGAGCACGCTC
GGCTGGACGTTCCACCTGCTCGACCGGCACCCGCTGGTGCGGGCCCGGGTGCGCGCGGAG
GCACGGGCGGTCTTCGGCGACGGGACGCCCACCCTGGACGACCTCTCCGCGCTGTCGTAC
ACCACGATGGTCGTGCAGGAGGTCATGCGGATGTACCCGCCCGTGTGGATCCTCACGCGG
GTGGCGCAGCGGGACGACGAGGTCGGCGGGTACCGCGTCCCGGCGGGCGCCGACGTGCTC
GTCTGCCCCTACACGTTGCACCGTAACCCGGATTTCTGGGAATGGCCCGATGTGTTCGAC
CCCGATCGCTTCGGTCCCGGGCGCTCCGAGGGCCGGCCGCGCTACGCCTACATCCCGTTC
GGGGCCGGTCCGCGCTTCTGCGTCGGCAACCACCTCGGCATGATGGAGGCCGTCTTCGTG
ACGGCCATGGTGGCGCGCGACCTGCGGCTGACCGGGGTGCCCGGCCGCGACGCCGTGCCC
GAGCCGATGCTGTCCCTGCGGGTGCGCGGGGGCCTGCCGATGACGGTGCACGACGACGCC
GGCGCCGGCGCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [271-288]  3.0999994589937e-13 PR00385 [323-334]  3.0999994589937e-13 PR00385 [398-407]  3.0999994589937e-13 PR00385 [407-418]  3.0999994589937e-13 PR00385
PR00385   P450
 [20-458]  3.699978135861e-110 SSF48264
SSF48264   Cytochrome_P450
 [42-440]  1.69999999999998e-77 PF00067
PF00067   p450
 [31-457]  2.59999999999995e-111 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002401 Cytochrome P450, E-class, group I (Family)
 [46-65]  2.60000517657733e-19 PR00463 [260-277]  2.60000517657733e-19 PR00463 [280-306]  2.60000517657733e-19 PR00463 [362-386]  2.60000517657733e-19 PR00463 [397-407]  2.60000517657733e-19 PR00463 [407-430]  2.60000517657733e-19 PR00463
PR00463   EP450I
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [400-409]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit