close all open/close all

CDS information : Madu_00420


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction63,617 / 63,066 / - [in whole cluster]
63,617 / 63,066 / - [in contig]
Locationcomplement(63066..63617) [in whole cluster]
complement(63066..63617) [in contig]
TypeCDS
Length552 bp (183 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative NADH-dependent FAD reductase
Product (GenBank)flavin reductase
Gene
Gene (GenBank)mdpE6
EC number
Keyword
  • two-component system
  • (S)-3-(2-chloro-3-hydroxy-4-methoxyphenyl)-3-hydroxypropionic acid
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q8GME2
NITE
C1027_00510
PmId
[19817865] Characterization of SgcE6, the flavin reductase component supporting FAD-dependent halogenation and hydroxylation in the biosynthesis of the enediyne antitumor antibiotic C-1027. (FEMS Microbiol Lett. , 2009)

close this sectionSequence

selected fasta
>putative NADH-dependent FAD reductase [flavin reductase]
MSVDPGQSPGEVGADMTATDLRRAFGTFATGVTVVTVGGREPHGMTANSFTSVSLDPPLV
LVCVGRSAVMHQRLAVGSFGISVLGAGQESVARYFADLSRPLGAAQFDRIGCTPGRATGA
PLIDGALAHYECELWSTAEAGDHTIFVGRLLTVHRAEPGPGEGLLFYQGRFRRLEPGRSE
VKA
selected fasta
>putative NADH-dependent FAD reductase [flavin reductase]
ATGAGCGTCGATCCCGGTCAGTCCCCGGGCGAGGTCGGCGCGGACATGACGGCCACCGAC
CTGCGCCGGGCCTTCGGGACGTTCGCCACGGGCGTCACCGTGGTCACCGTCGGCGGCCGC
GAGCCGCACGGCATGACCGCGAACTCCTTCACCTCGGTCTCGCTCGACCCGCCGCTGGTG
CTGGTCTGCGTCGGGCGCAGCGCGGTCATGCACCAGCGGCTGGCCGTCGGCTCCTTCGGC
ATCTCGGTGCTGGGGGCCGGGCAGGAGTCGGTGGCGCGGTACTTCGCGGACCTGTCCCGC
CCGCTGGGCGCGGCCCAGTTCGACCGGATCGGCTGCACGCCGGGCCGGGCCACCGGGGCG
CCGCTGATCGACGGCGCGCTCGCGCACTACGAGTGCGAGCTGTGGAGCACCGCCGAGGCG
GGGGACCACACGATCTTCGTCGGGCGGCTGCTGACGGTGCACCGCGCCGAGCCGGGGCCC
GGCGAGGGGCTGCTGTTCTACCAGGGCCGCTTCCGGCGGCTGGAGCCCGGACGGAGCGAG
GTGAAGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002563 Flavin reductase-like, FMN-binding (Domain)
 [25-173]  1.79999754022375e-55 SM00903
SM00903   Flavin_Reduct
 [26-174]  4.39999999999997e-36 PF01613
PF01613   Flavin_Reduct
IPR009002 FMN-binding split barrel-related (Domain)
 [13-182]  5.8999880940569e-47 SSF50475
SSF50475   FMN_binding
IPR012349 FMN-binding split barrel (Domain)
 [16-176]  2.4e-52 G3DSA:2.30.110.10
G3DSA:2.30.110.10   PNPOx_FMN_bd
SignalP No significant hit
TMHMM No significant hit