close all open/close all

CDS information : Madu_00430


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction64,072 / 63,614 / - [in whole cluster]
64,072 / 63,614 / - [in contig]
Locationcomplement(63614..64072) [in whole cluster]
complement(63614..64072) [in contig]
TypeCDS
Length459 bp (152 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative thioesterase
Product (GenBank)type II thioesterase
Gene
Gene (GenBank)mdpE10
EC number
Keyword
  • TEBC family
  • enediyne core
Note
  • Similar to Hotdog-fold thioesterase.
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
Related Reference
ACC
Q8KNG2
NITE
Calm_00350
PmId
[19357082] Structure and catalytic mechanism of the thioesterase CalE7 in enediyne biosynthesis. (J Biol Chem. , 2009)
ACC
Q84HI7
NITE
Dynm_00190
PmId
[20888341] Induced-fit upon ligand binding revealed by crystal structures of the hot-dog fold thioesterase in dynemicin biosynthesis. (J Mol Biol. , 2010)

close this sectionSequence

selected fasta
>putative thioesterase [type II thioesterase]
MDNHYEYRHTVGFEETNIVGNVYYVNYLSWQGRCREMFLKERAPDVLAEIQDDLKLFTLK
VSCEFFAEITAFDELSIRMHLLELAQTQLEFGFEYVRLDPGGLETLIARGRQRVACMRGP
NTRTAPARVPDALVSALRPYTREAPSPAGRAS
selected fasta
>putative thioesterase [type II thioesterase]
ATGGACAACCATTACGAATACCGGCACACGGTCGGTTTCGAGGAGACCAACATCGTCGGC
AACGTCTACTACGTCAACTATCTGAGCTGGCAGGGGCGCTGCCGGGAGATGTTCCTCAAG
GAACGCGCCCCCGACGTGCTCGCCGAGATCCAGGACGACCTGAAGCTGTTCACGCTGAAG
GTGAGCTGCGAGTTCTTCGCCGAGATCACGGCGTTCGACGAGCTGTCCATCCGGATGCAC
CTGCTGGAACTGGCGCAGACGCAGCTGGAGTTCGGCTTCGAGTACGTGCGGCTCGACCCG
GGCGGGCTGGAGACCCTGATCGCCCGGGGCCGCCAGCGGGTGGCCTGCATGCGCGGCCCC
AACACCCGGACGGCACCGGCGCGGGTCCCCGACGCGCTGGTCAGCGCGCTGCGTCCGTAC
ACCAGGGAGGCGCCGAGCCCGGCGGGGAGGGCGTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit