close all open/close all

CDS information : Madu_00440


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction69,911 / 64,077 / - [in whole cluster]
69,911 / 64,077 / - [in contig]
Locationcomplement(64077..69911) [in whole cluster]
complement(64077..69911) [in contig]
TypeCDS
Length5,835 bp (1,944 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)enediyne polyketide synthase
Gene
Gene (GenBank)mdpE
EC number
Keyword
  • iterative
  • enediyne core
Note
Note (GenBank)
  • enediyne PKS; MadE
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
[25019332] Enediyne polyketide synthases stereoselectively reduce the beta-ketoacyl intermediates to beta-D-hydroxyacyl intermediates in enediyne core biosynthesis. (Org Lett. , 2014)
Related Reference
ACC
Q8GME1
NITE
C1027_00520
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
[14528002] Rapid PCR amplification of minimal enediyne polyketide synthase cassettes leads to a predictive familial classification model. (Proc Natl Acad Sci U S A. , 2003)
[18223152] A phosphopantetheinylating polyketide synthase producing a linear polyene to initiate enediyne antitumor antibiotic biosynthesis. (Proc Natl Acad Sci U S A. , 2008)
[25019332] Enediyne polyketide synthases stereoselectively reduce the beta-ketoacyl intermediates to beta-D-hydroxyacyl intermediates in enediyne core biosynthesis. (Org Lett. , 2014)
ACC
Q84HI8
NITE
Dynm_00180
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
[22589546] Crystal structure of the acyltransferase domain of the iterative polyketide synthase in enediyne biosynthesis. (J Biol Chem. , 2012)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
[25019332] Enediyne polyketide synthases stereoselectively reduce the beta-ketoacyl intermediates to beta-D-hydroxyacyl intermediates in enediyne core biosynthesis. (Org Lett. , 2014)

close this sectionPKS/NRPS Module

A1 acetyl-CoA
malonyl-CoA
KS4..414
AT618..846
ACP934..1028
KR1217..1397
DH1467..1622
PPT1722..1937

close this sectionSequence

selected fasta
>polyketide synthase [enediyne polyketide synthase]
MSSTRLAVVGAACRYPDAASPRELWENALAGRRAFRRLPDERMRLEDYWDADPAAPDRFY
ASKAAVIEGYEFDRVAHRIAGSTYRSTDLTHWLALDVAGRALADAGFPEGRDLPRERTGV
IVGNTLTGEFTRANVLRLRWPYVRRVVAAGLREQEGWDDDRLGAFLDDLEEAYKEPFPAI
DEDSLAGGLSNTIAGRVCNHFDLKGGGYTVDGACSSSLLSVATACRSLLDRDIDVAVAGG
VDLSIDPFEIIGFAKTGALARGEMRLYDRRSNGFWPGEGCGMVVLMREEDARAQGRRIYA
TVAGWGVSSDGRGGITRPEADGYRLALSRAYERAGFGIDTVALFEGHGTGTEVGDTTELT
ALSLARRAAAPQAAPAAVGSVKGMIGHTKAAAGVAGLIKAVMAVRDQVLPPTTGCVDPHP
LLADDDAALRVLRKAEPWPADAPVRAGVTAMGFGGINTHIVLEGADERRRVPFDTRTRAL
AASVQDAELLLVDADSADALRARVAELAEFVPKLAYAQLSDLAAVLQRDLGDRPYRAAVV
ASSPEHAEARLRRVLAVLESGESGLHAPDGGAFLGRVSGRGRIGFLFPGQGSGTGTAGGA
LRRRFAEVEDVYLRAKLPERGDMIATHVAQPRIVTGAMAGLRALSLLGLEAEAAVGHSLG
ELSALHWAGAMDEDALLRVAGVRGRTMAEHSASGTMASARCSAAEAAALVGDRPVVIAGH
NGPAQTVLAGSVEDIEAVGRDAAANGVSWVRLPVSHAFHSPLVAPAADAFARELDGERFG
PVGRRVVSTVTGDGLAAGADVRALLRRQITDPVLFGRAVEVAAKDVDLFVEVGPGRVLTG
LATDITEVPAVAMDTDDESLGGFLTVLAAAYVRGAPVRHEVLFHGRLARPLEIGAEFSFF
ASPCETPPPVRITGTGRRSGRAVPVPDAPADGAAAGGAEADAAEPSIDLLRRLLAERVEL
PPEMVADDSRPLDDLHLSSITVGQVVNQAVRLRGLAVTQAPTNFATATLRELAETLDTLA
ETALPGDLEPGSAVAGAAAWARAFSLDLDTEPLPRPATSTAPSLAAGGAGGWTVHATEGH
PLAGPLRDALERAGAGPGVLVCLPPDCTDDQLEPALDGVRDALAGAPGTRFVLVQDGRGA
AGLARTLRLEAPHLRVTIVHTPPSADAVDRVVAEVAATGEFAEAYYGADGERRVPTLRAM
PVRAARGDPPLDSSDVLLVTGGGKGITAECALAVAADTGARLAVLGRSDPAEDAELAANL
ARMSDAGATVRYARADVADPVRVAAAVAELTESLGPVTGVLHGAGRNVPAGLAGLDMPEI
HRTLAPKTGGLEAVLAAVDPARLKLLVTFGSIIGRAGLRGEGHYATANDRLAQLTREFAG
RHPDCRTLCMEWSVWSGVGMGERLSVVEGLGREGITAITPDQGVEIMRRLVADPDAPSVV
VISGRTGTIDTVRHDAPELPLLRFTGRPLVRYHGVELVAETELNVGSDPYLADHLLDGNL
LFPAVLGMEAMAQAASAATGREEPPAFEGAEFLRPIVVPPEGSTTIRVAATVVDDGAVQV
AIRTADTDFAADHFTARLVYPDGPLPDGPPDQVGDGLPEVPLDPAADLYGGVLFQGARFQ
RLRRYHRAAARHVDADVAAVPAGGWFAGFLPGGMLLADPGMRDALMHGNQVCVPDATLLP
SGVERLRPAGPGVVGDLRYCATERERDGDTYVYDIAVRDATGAVVERWDGLRLQAVRKGD
GRGPWVPPLLGSYLERELEDLLGVHVAVAVEPDPPAEANGGRGDRTAAAAARASGGAVSV
RRRPDGRPELGDGRPVSASHGSGVTLCVVADEPGAGPLGCDVETVAERAPADWAGLLGDA
AALAKVIAAERAERYATAATRVWAAIESVRKAGLPADAPLTLAPAGAGPWVVVASGGLRI
ATLVTALRDEPDPVVLAVLVEGRS
selected fasta
>polyketide synthase [enediyne polyketide synthase]
ATGAGCAGCACCCGCCTCGCCGTCGTCGGTGCGGCATGCCGCTATCCGGACGCGGCGTCC
CCCCGGGAGCTCTGGGAGAACGCCCTCGCCGGGCGCCGCGCGTTCCGCCGGCTGCCCGAC
GAGCGGATGCGGCTGGAGGACTACTGGGACGCCGATCCCGCCGCCCCCGACCGGTTCTAC
GCCAGCAAGGCCGCCGTCATCGAGGGCTACGAGTTCGACCGCGTCGCCCACCGCATCGCC
GGCAGCACCTACCGCTCCACCGACCTCACCCACTGGCTGGCGCTCGACGTCGCCGGACGG
GCGCTGGCCGACGCGGGCTTCCCGGAGGGCCGGGACCTGCCCCGCGAGCGCACGGGGGTG
ATCGTGGGCAACACCCTCACCGGCGAGTTCACCCGCGCCAACGTGCTGCGGCTGCGCTGG
CCGTACGTGCGGCGCGTGGTGGCCGCCGGGCTCCGCGAGCAGGAAGGCTGGGACGACGAC
CGGCTGGGCGCGTTCCTGGACGACCTGGAGGAGGCGTACAAGGAACCGTTCCCGGCCATC
GACGAGGACTCCCTCGCCGGCGGCCTGTCCAACACCATCGCCGGACGCGTCTGCAACCAC
TTCGACCTCAAGGGCGGCGGCTACACGGTCGACGGCGCGTGCTCGTCCTCGCTGCTGTCG
GTGGCCACGGCCTGCCGGTCGCTGCTCGACCGCGACATCGACGTCGCGGTCGCCGGCGGG
GTGGACCTGTCCATCGACCCGTTCGAGATCATCGGGTTCGCCAAGACGGGCGCGCTGGCC
CGCGGCGAGATGCGCCTCTACGACCGCCGCTCCAACGGCTTCTGGCCGGGGGAGGGCTGC
GGCATGGTCGTGCTGATGCGGGAGGAGGACGCCCGCGCCCAGGGGCGGCGGATCTACGCG
ACCGTCGCCGGCTGGGGCGTCTCGTCCGACGGCCGCGGCGGCATCACCCGGCCGGAGGCC
GACGGCTACCGGCTGGCGCTGAGCCGCGCGTACGAGCGCGCGGGCTTCGGCATCGACACC
GTCGCGCTGTTCGAGGGGCACGGCACGGGCACCGAGGTCGGCGACACGACCGAGCTGACG
GCGCTGTCGCTGGCCCGCCGGGCGGCCGCCCCGCAGGCCGCGCCCGCCGCGGTCGGTTCC
GTCAAGGGGATGATCGGGCACACCAAGGCCGCGGCCGGCGTGGCCGGGCTGATCAAGGCC
GTGATGGCGGTCCGCGACCAGGTCCTGCCGCCGACCACCGGCTGCGTCGACCCGCACCCG
CTGCTCGCGGACGACGACGCGGCGCTGCGGGTGCTGCGCAAGGCCGAGCCGTGGCCCGCG
GACGCGCCGGTGCGCGCGGGCGTCACCGCGATGGGCTTCGGCGGCATCAACACCCACATC
GTGCTGGAGGGGGCGGACGAGCGCAGGCGCGTCCCGTTCGACACCCGCACCCGCGCGCTG
GCGGCGTCGGTCCAGGACGCCGAACTGCTGCTGGTCGACGCCGACTCCGCGGACGCGCTG
CGGGCCAGGGTCGCGGAACTGGCCGAGTTCGTGCCGAAACTGGCGTACGCGCAGCTGTCC
GACCTGGCCGCCGTGCTCCAGCGGGACCTGGGCGACCGGCCGTACCGGGCCGCCGTCGTG
GCCTCCTCGCCTGAGCACGCGGAGGCGCGCCTCCGCCGGGTGCTGGCCGTGCTGGAGTCG
GGGGAGAGCGGCCTGCACGCCCCCGACGGCGGCGCGTTCCTCGGCCGGGTGAGCGGGCGG
GGCCGCATCGGCTTCCTGTTCCCCGGCCAGGGCTCGGGCACCGGCACCGCCGGGGGCGCG
CTGCGCCGCCGCTTCGCCGAGGTCGAGGACGTCTACCTGCGGGCGAAGCTGCCCGAGCGG
GGCGACATGATCGCCACGCACGTGGCGCAGCCGCGCATCGTCACCGGCGCGATGGCGGGG
CTGCGGGCGCTGTCCCTGCTGGGCCTGGAGGCGGAGGCCGCGGTCGGCCACAGCCTCGGC
GAGCTGTCCGCGCTGCACTGGGCCGGGGCGATGGACGAGGACGCGCTGCTGCGCGTCGCG
GGGGTGCGCGGCCGGACCATGGCCGAGCACAGCGCGTCCGGGACGATGGCGAGCGCCAGA
TGCTCCGCCGCCGAGGCGGCGGCGCTGGTCGGGGACCGTCCGGTGGTGATCGCCGGTCAC
AACGGCCCCGCCCAGACCGTGCTGGCCGGTTCGGTCGAGGACATCGAGGCGGTGGGCCGC
GACGCGGCGGCGAACGGGGTCAGCTGGGTGCGCCTGCCGGTCTCGCACGCCTTCCACTCC
CCGCTGGTCGCCCCGGCCGCCGACGCCTTCGCCCGCGAGCTCGACGGCGAACGGTTCGGG
CCGGTCGGACGGCGCGTGGTGTCGACCGTCACCGGCGACGGGCTGGCCGCCGGCGCCGAC
GTCCGGGCGCTGCTGCGCCGCCAGATCACCGACCCGGTGCTGTTCGGCCGGGCGGTGGAG
GTCGCGGCCAAGGACGTCGACCTGTTCGTGGAGGTCGGCCCCGGGCGGGTGCTCACCGGG
CTGGCCACCGACATCACCGAGGTGCCCGCCGTCGCGATGGACACCGACGACGAGTCGCTC
GGCGGGTTCCTCACCGTGCTCGCCGCCGCGTACGTGCGCGGCGCGCCCGTCCGGCACGAG
GTCCTGTTCCACGGCAGGCTGGCCCGGCCCCTGGAGATCGGGGCGGAGTTCTCCTTCTTC
GCGAGCCCCTGCGAGACGCCGCCGCCGGTCCGCATCACCGGGACGGGCCGCCGGAGCGGC
CGAGCCGTCCCGGTACCGGACGCGCCTGCGGACGGTGCGGCGGCCGGCGGTGCGGAGGCC
GACGCGGCGGAGCCCTCCATCGACCTGCTGCGGCGGCTGCTGGCCGAGCGCGTGGAGCTG
CCGCCCGAGATGGTGGCCGACGACAGCAGGCCGCTGGACGACCTGCACCTCAGCTCGATC
ACCGTCGGGCAGGTCGTGAACCAGGCGGTGCGGCTGCGGGGCCTGGCGGTGACGCAGGCC
CCGACCAACTTCGCGACCGCCACGCTCCGCGAGCTGGCCGAGACGCTCGACACGCTCGCC
GAGACCGCCCTCCCGGGCGACCTGGAGCCGGGTTCCGCGGTCGCGGGGGCCGCCGCGTGG
GCGCGCGCCTTCTCCCTCGACCTCGACACCGAACCGCTGCCTCGGCCCGCGACGTCCACC
GCCCCCTCCCTCGCGGCGGGCGGCGCCGGCGGGTGGACGGTCCACGCCACCGAAGGGCAT
CCGCTGGCCGGGCCGCTCCGCGACGCGCTGGAGCGGGCGGGCGCCGGTCCCGGCGTCCTG
GTCTGCCTGCCCCCCGACTGCACCGACGACCAGCTGGAACCGGCCCTGGACGGGGTGCGG
GACGCGCTGGCGGGCGCGCCGGGCACCCGGTTCGTCCTGGTCCAGGACGGGCGCGGCGCG
GCCGGGCTCGCCCGGACCCTCCGCCTGGAGGCGCCGCACCTGCGCGTCACGATCGTGCAC
ACCCCGCCGTCCGCGGACGCCGTCGACCGGGTCGTCGCCGAGGTGGCGGCGACCGGGGAG
TTCGCCGAGGCGTACTACGGCGCCGACGGCGAGCGCCGCGTCCCCACGCTGCGGGCGATG
CCCGTGCGCGCGGCGCGCGGCGACCCGCCGCTGGACTCCTCGGACGTGCTGCTGGTGACG
GGCGGCGGCAAGGGGATCACCGCGGAGTGCGCGCTCGCCGTCGCCGCCGACACCGGCGCC
CGGCTCGCCGTGCTCGGCCGCTCCGACCCCGCCGAGGACGCCGAACTGGCGGCGAACCTG
GCGCGGATGTCCGACGCCGGGGCGACCGTCCGCTACGCCCGCGCCGACGTCGCCGACCCG
GTCCGGGTCGCCGCCGCGGTCGCGGAGCTGACCGAGTCGCTCGGCCCGGTCACCGGCGTC
CTGCACGGGGCGGGACGGAACGTTCCGGCCGGTCTCGCCGGGCTGGACATGCCGGAGATC
CACCGCACCCTCGCGCCCAAGACGGGCGGGCTGGAGGCGGTGCTCGCCGCCGTCGACCCC
GCCCGGCTGAAGCTGCTCGTCACGTTCGGCAGCATCATCGGACGCGCCGGGCTGCGCGGG
GAGGGCCACTACGCCACCGCCAACGACCGGCTCGCGCAGCTGACCCGCGAGTTCGCCGGC
CGGCATCCGGACTGCCGGACGCTCTGCATGGAGTGGTCGGTGTGGTCGGGCGTCGGCATG
GGCGAGCGGCTGTCGGTGGTCGAGGGCCTCGGCCGCGAGGGCATCACCGCCATCACCCCC
GACCAGGGCGTCGAGATCATGCGGCGGCTCGTCGCCGATCCGGACGCCCCGTCCGTCGTG
GTGATCAGCGGCCGCACCGGGACGATCGACACCGTGCGCCACGACGCGCCGGAGCTGCCG
CTGTTGCGGTTCACGGGGCGGCCGCTCGTCCGGTACCACGGCGTCGAGCTGGTCGCCGAG
ACCGAGCTCAACGTCGGCTCCGACCCGTACCTGGCCGACCACCTGCTGGACGGGAACCTG
CTGTTCCCGGCCGTCCTCGGGATGGAGGCGATGGCCCAGGCGGCGTCCGCCGCCACCGGC
CGGGAGGAGCCGCCCGCCTTCGAGGGGGCGGAGTTCCTGCGGCCGATCGTCGTCCCGCCC
GAGGGCAGCACCACGATCCGCGTCGCCGCGACCGTCGTCGACGACGGCGCGGTCCAGGTC
GCGATCCGCACGGCCGACACCGACTTCGCCGCCGACCACTTCACCGCGCGGCTGGTGTAC
CCGGACGGACCGCTCCCGGACGGCCCCCCGGACCAGGTCGGCGACGGCCTGCCCGAGGTC
CCGCTCGACCCGGCCGCGGACCTGTACGGCGGCGTCCTGTTCCAGGGCGCCCGCTTCCAG
CGGCTGCGCCGGTACCACCGGGCCGCGGCCCGGCACGTGGACGCCGACGTCGCCGCGGTC
CCCGCCGGGGGCTGGTTCGCCGGGTTCCTGCCCGGCGGCATGCTGCTGGCCGACCCCGGC
ATGCGGGACGCGCTGATGCACGGCAACCAGGTGTGCGTCCCGGACGCGACCCTGCTGCCG
TCCGGCGTCGAACGGCTGCGGCCCGCGGGTCCCGGCGTCGTCGGCGACCTGCGGTACTGC
GCCACCGAACGGGAGCGGGACGGCGACACGTACGTGTACGACATCGCCGTCCGGGACGCG
ACCGGCGCCGTCGTCGAACGGTGGGACGGGCTGCGCCTCCAGGCCGTCCGGAAGGGGGAC
GGGCGCGGCCCGTGGGTGCCCCCGCTGCTCGGCTCGTACCTGGAACGTGAACTGGAGGAC
CTCCTCGGCGTGCACGTCGCGGTCGCCGTGGAGCCCGACCCGCCCGCCGAGGCGAACGGG
GGGCGGGGCGACCGGACGGCGGCGGCCGCCGCCCGCGCGAGCGGCGGCGCGGTGTCCGTG
CGGCGCCGCCCGGACGGCCGTCCCGAACTGGGCGACGGCCGGCCGGTCTCCGCCTCGCAC
GGTTCGGGCGTCACCCTCTGCGTCGTCGCGGACGAGCCCGGCGCGGGCCCGCTCGGCTGC
GACGTCGAGACGGTCGCGGAGCGGGCCCCGGCGGACTGGGCCGGGCTGCTCGGCGACGCC
GCCGCGCTGGCGAAGGTGATCGCCGCGGAGCGCGCCGAGCGGTACGCGACCGCCGCCACC
CGAGTCTGGGCGGCGATCGAGAGCGTCCGCAAGGCGGGCCTGCCGGCCGACGCCCCGCTG
ACCCTCGCGCCGGCCGGCGCCGGGCCGTGGGTGGTCGTGGCCTCCGGCGGCCTGCGGATC
GCGACCCTCGTCACCGCCCTGCGGGACGAGCCGGACCCGGTCGTGCTCGCGGTACTCGTG
GAAGGACGGTCGTAA
[1] KS4..414
[1] AT618..846
[1] acetyl-CoA malonyl-CoA756..760
[1] ACP934..1028
[1] KR1217..1397
[1] DH1467..1622
[1] PPT1722..1937
[1] KS10..1242
[1] AT1852..2538
[1] acetyl-CoA malonyl-CoA2266..2280
[1] ACP2800..3084
[1] KR3649..4191
[1] DH4399..4866
[1] PPT5164..5811

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [583-687]  6e-36 G3DSA:3.40.366.10 [755-851]  6e-36 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR009081 Acyl carrier protein-like (Domain)
 [944-1021]  4.69999810630989e-06 SSF47336
SSF47336   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1217-1397]  1.5e-28 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [4-291]  5.19999999999996e-52 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [299-414]  2.1e-30 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [618-846]  2.6e-26 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [582-863]  1.10000150671643e-40 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [692-755]  5.29999657550189e-13 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [7-127]  1.09999999999999e-61 G3DSA:3.40.47.10 [161-303]  1.09999999999999e-61 G3DSA:3.40.47.10 [304-468]  5.10000000000004e-45 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [4-298]  2.60000517657733e-60 SSF53901 [258-471]  1.49999648196323e-53 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1216-1436]  6.50000000000001e-26 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit