close all open/close all

CDS information : Madu_00450


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction70,900 / 69,908 / - [in whole cluster]
70,900 / 69,908 / - [in contig]
Locationcomplement(69908..70900) [in whole cluster]
complement(69908..70900) [in contig]
TypeCDS
Length993 bp (330 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Producthypothetical protein
Product (GenBank)unknown
GenemdpE5
unbU
Gene (GenBank)mdpE5
EC number
Keyword
  • enediyne core
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MSETKATPPRHDPKVVTALRNFAMSMSVFNILGYTILGFEQPWTWPFIALATAYTFEALL
EAIGAKVEGRTPRFAGRGFRGVMEFLYPAHITALAMNMLIYVNDRVWVMVFGVLVAVGAK
WVLRAPVRGRMRHYMNPSNFGITAILLLFPWASIAPPYHFTERFDAPVDWLVPVIILSAG
TMLNAKLTGRMWLIMGWLSIYVVQAVVRGWLLDTSIPAALIMMTGVAFVLYTNYMVTDPG
TSPSAPAAQFAFGGGIAIIYGFLTGAGIAYGLFFATALVCLIRGVYLWALHFSNKAREER
ATAEAATHDAAANGRSGAGRPDSGKEVVPA
selected fasta
>hypothetical protein [unknown]
ATGTCCGAGACCAAGGCAACCCCACCGCGTCACGACCCGAAGGTCGTCACGGCGCTGCGC
AACTTCGCCATGTCGATGTCGGTCTTCAACATCCTGGGCTACACGATCCTCGGGTTCGAG
CAGCCGTGGACCTGGCCGTTCATCGCGCTGGCCACCGCGTACACGTTCGAGGCCCTGCTG
GAGGCCATCGGGGCCAAGGTGGAGGGCCGCACCCCCCGCTTCGCGGGCCGCGGCTTCCGC
GGCGTCATGGAGTTCCTCTACCCGGCGCACATCACCGCCCTGGCGATGAACATGCTGATC
TACGTCAATGACCGCGTGTGGGTCATGGTCTTCGGCGTGTTGGTCGCGGTCGGGGCCAAG
TGGGTGCTGCGGGCCCCGGTGCGGGGCCGTATGCGGCACTACATGAACCCGTCGAACTTC
GGCATCACCGCCATCCTGCTGCTGTTCCCGTGGGCCAGCATCGCCCCGCCGTACCACTTC
ACCGAGCGGTTCGACGCCCCCGTCGACTGGCTCGTCCCGGTGATCATCCTGAGCGCGGGC
ACGATGCTCAACGCCAAGCTCACCGGGCGGATGTGGCTGATCATGGGCTGGCTCTCGATC
TACGTCGTCCAGGCCGTGGTCCGCGGCTGGCTGCTGGACACCTCGATCCCGGCGGCACTG
ATCATGATGACCGGCGTCGCGTTCGTCCTCTACACCAACTACATGGTGACCGACCCCGGC
ACCAGCCCGTCGGCGCCGGCCGCGCAGTTCGCCTTCGGCGGCGGCATCGCGATCATCTAC
GGCTTCCTCACCGGGGCGGGCATCGCGTACGGCCTGTTCTTCGCGACGGCGCTCGTCTGC
CTCATCCGCGGCGTCTACCTGTGGGCGCTGCACTTCTCGAACAAGGCGCGCGAGGAACGG
GCGACGGCCGAGGCCGCCACCCACGACGCCGCCGCCAACGGCCGGTCCGGTGCCGGACGG
CCCGACTCCGGCAAGGAGGTCGTGCCCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM
 [21-38]  Transmembrane (i-o) [43-65]  Transmembrane (o-i) [85-102]  Transmembrane (i-o) [106-123]  Transmembrane (o-i) [136-155]  Transmembrane (i-o) [170-189]  Transmembrane (o-i) [210-232]  Transmembrane (i-o) [252-274]  Transmembrane (o-i)
Transmembrane 8