close all open/close all

CDS information : Madu_00460


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction72,943 / 70,907 / - [in whole cluster]
72,943 / 70,907 / - [in contig]
Locationcomplement(70907..72943) [in whole cluster]
complement(70907..72943) [in contig]
TypeCDS
Length2,037 bp (678 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Producthypothetical protein
Product (GenBank)unknown
GenemdpE4
unbV
Gene (GenBank)mdpE4
EC number
Keyword
  • enediyne core
Note
Note (GenBank)
  • MadE4
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
Related Reference
ACC
Q84HJ0
NITE
Dynm_00160
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MSASYGWLRKQLPGVVALVLVVGAFFVVKLPEAPAAEKADVAARYGFEPMSIAMPGGFAQ
QTIREVNKDYENIDAWISSVGAGVAMNDLDGDGLPNDLCITDPRIDRVVVTPAPGARSDR
YASFALETGPLPMNDAMAPMGCAPGDFNEDGRMDLLVYMWGRTPIVHLARADAGKLTADA
YVPTELVPNAGGRAYTGPQWNSNAVAIDDFDGDGHYDIYLGNYFPHGPVLDPRKSGGVEM
NRSLSNATNAGEDYFFRWTGATAGERPSVEFEQLDDVLPREISKGWVLAAGANDLDGDQR
PELYIAQDHGKDALLYNISTPGKIEFQAVHGARTPGLPKSLRIGDDSFKGMGIDFADFDH
DGLYDMFVSNITTTFGIQESNLHFYNTAKNQADLRTRLRDGDAPWTDRSADKGTAWSGWA
WDVKVGDFDNSGDPAIAQTNGFVKGEVNRWPQLQELAASNDLVVEDPRWWPHVRAGDDIA
GSQRLTFWAPDDDGGYVNVSDELGLAIPVPTRGIAVGDADGDGRLDMAVARQWEEPVFYH
NTAPSPGAHLNLRLTHDTEDGDSGSGGSEPAEGALPAPGSPVVGAQVKVTTPDGRAHLAR
VDGGSGHSGKRSDEVHIGLGAGVTGPVRVELCWRDRSGTEHRQELRLAPGRHSLRLGAGA
EVVRPDQPQDTQTPAEEE
selected fasta
>hypothetical protein [unknown]
GTGTCCGCGAGCTATGGCTGGCTGCGCAAGCAGCTACCGGGCGTTGTGGCGCTCGTACTG
GTGGTCGGGGCGTTCTTCGTGGTCAAGCTGCCCGAGGCGCCCGCCGCCGAGAAGGCCGAT
GTGGCGGCCCGGTACGGGTTCGAGCCGATGAGCATCGCGATGCCGGGCGGCTTCGCGCAG
CAGACGATCCGCGAGGTCAACAAGGACTACGAGAACATCGACGCCTGGATCTCCTCCGTC
GGAGCCGGCGTCGCGATGAACGACCTCGACGGCGACGGGCTGCCCAACGACCTGTGCATC
ACCGATCCGCGGATCGACAGGGTCGTGGTGACCCCGGCTCCGGGCGCCCGCTCGGACCGG
TACGCGTCGTTCGCGCTGGAGACCGGCCCGCTGCCGATGAACGACGCGATGGCCCCGATG
GGGTGCGCCCCCGGCGACTTCAACGAGGACGGCCGGATGGACCTGCTGGTCTACATGTGG
GGCCGCACCCCGATCGTCCATCTCGCCCGCGCGGACGCCGGGAAGCTGACGGCGGACGCG
TACGTCCCGACCGAGCTGGTGCCGAACGCGGGCGGCCGGGCCTACACGGGGCCGCAGTGG
AACTCCAACGCCGTGGCGATCGACGACTTCGACGGCGACGGCCACTACGACATCTACCTG
GGGAACTACTTCCCGCACGGTCCCGTGCTCGATCCCCGCAAGAGCGGCGGCGTCGAGATG
AACCGGTCGCTGTCGAACGCGACCAACGCCGGGGAGGACTACTTCTTCCGCTGGACGGGC
GCCACCGCCGGTGAACGTCCGTCGGTCGAGTTCGAGCAGCTCGACGACGTGCTCCCGCGC
GAGATCTCCAAGGGCTGGGTGCTGGCGGCCGGGGCGAACGACCTCGACGGCGACCAGCGC
CCCGAGCTCTACATCGCCCAGGACCACGGCAAGGACGCCCTCCTCTACAACATTTCCACT
CCCGGAAAGATCGAATTCCAGGCCGTGCACGGGGCCCGCACTCCGGGCCTGCCGAAGTCG
CTGCGGATCGGCGACGATTCCTTCAAGGGTATGGGAATCGATTTCGCCGATTTCGATCAC
GACGGCCTGTACGACATGTTCGTCAGCAACATCACGACGACGTTCGGCATCCAGGAGAGC
AATCTCCATTTCTACAACACCGCGAAGAACCAGGCCGATCTCCGGACCAGGCTGCGTGAC
GGAGACGCGCCGTGGACGGACCGCAGCGCCGACAAGGGCACCGCGTGGTCCGGCTGGGCC
TGGGACGTCAAGGTGGGCGACTTCGACAACAGCGGCGACCCCGCCATCGCCCAGACCAAC
GGGTTCGTCAAGGGCGAGGTGAACCGGTGGCCCCAGCTGCAGGAACTCGCCGCCTCCAAC
GACCTGGTCGTGGAGGACCCGCGCTGGTGGCCGCACGTGCGGGCCGGTGACGACATCGCC
GGCAGCCAGCGGCTGACCTTCTGGGCCCCGGACGACGACGGCGGGTACGTGAACGTGTCC
GACGAGCTCGGCCTGGCCATCCCGGTGCCCACCCGCGGGATCGCGGTCGGCGACGCCGAC
GGCGACGGCCGGCTCGACATGGCCGTGGCCCGCCAGTGGGAGGAGCCCGTCTTCTACCAC
AACACCGCCCCGTCGCCGGGCGCCCACCTCAACCTGCGGCTGACGCACGACACCGAGGAC
GGCGACTCCGGATCGGGCGGCTCCGAGCCGGCCGAGGGCGCGCTGCCCGCGCCGGGCAGC
CCGGTCGTCGGCGCGCAGGTGAAGGTCACCACCCCGGACGGGCGCGCGCACCTGGCCCGG
GTGGACGGCGGCAGCGGCCACTCCGGCAAGCGCAGCGACGAGGTGCACATCGGCCTGGGC
GCGGGGGTCACCGGCCCCGTGCGGGTCGAGCTGTGCTGGCGGGACCGCTCGGGCACGGAG
CACCGCCAGGAGCTGCGGCTCGCCCCCGGCCGGCACTCGCTACGGCTCGGCGCCGGCGCC
GAAGTCGTCCGGCCCGACCAGCCCCAGGACACGCAGACCCCGGCCGAGGAGGAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011519 ASPIC/UnbV (Domain)
 [581-654]  5.09999999999998e-20 PF07593
PF07593   UnbV_ASPIC
IPR013517 FG-GAP repeat (Repeat)
 [201-235]  9.39999999999999e-06 PF01839
PF01839   FG-GAP
SignalP
 [1-35]  0.583 Signal
Bacteria, Gram-positive   
TMHMM No significant hit