close all open/close all

CDS information : Madu_00470


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction73,849 / 72,947 / - [in whole cluster]
73,849 / 72,947 / - [in contig]
Locationcomplement(72947..73849) [in whole cluster]
complement(72947..73849) [in contig]
TypeCDS
Length903 bp (300 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Producthypothetical protein
Product (GenBank)hypothetical protein
GenemdpE3
unbL
Gene (GenBank)mdpE3
EC number
Keyword
  • enediyne core
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
Related Reference
ACC
Q84HJ1
NITE
Dynm_00150
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MKNAAGREVLETIGESFLAGFGHAVESGAPDAIPGLLRPVPTRYRGFAFEGAAMGFATVD
ALTFARGRRTDAYLRGTGDPHVYMAYIGVGWAMARLPRFRWPKPPADPLMRWFPLDGYGF
HQAYFKTDQYVHRHYRAARFPWPAHDPHGYADRALDQGIGRALWFVGGTDADVVAGLIEG
FAPDRRSDLYSGAGLAATYAGGADEDELRGFWKRAGEHRPFVAQGSAFAAEARRRAGLET
PHTEIGTRVFCDMDPDRAAQVCVEARPGREEALEEDGGAQPAFEVWRRRIADEFAAKGRC
selected fasta
>hypothetical protein [hypothetical protein]
GTGAAGAACGCCGCCGGCCGGGAGGTACTGGAGACGATCGGCGAGAGTTTCCTGGCGGGG
TTCGGCCACGCCGTCGAATCGGGCGCCCCGGACGCGATCCCGGGGCTGCTCCGGCCCGTC
CCGACGCGGTACCGGGGGTTCGCGTTCGAGGGCGCGGCGATGGGTTTCGCGACGGTCGAC
GCGCTGACGTTCGCGCGCGGCCGGCGGACGGACGCGTACCTGCGGGGAACGGGCGACCCG
CACGTCTACATGGCCTACATCGGGGTCGGCTGGGCGATGGCGCGGCTGCCGAGGTTCCGC
TGGCCGAAGCCGCCCGCGGACCCCCTCATGCGGTGGTTCCCGCTCGACGGGTACGGCTTC
CACCAGGCGTACTTCAAGACCGACCAGTACGTCCACCGGCACTACCGGGCGGCCCGGTTC
CCCTGGCCGGCGCACGACCCGCACGGCTACGCCGACCGCGCCCTCGACCAGGGAATCGGG
CGCGCACTGTGGTTCGTCGGCGGCACGGACGCCGACGTGGTGGCCGGGCTGATCGAGGGC
TTCGCCCCCGACCGGCGGTCCGACCTGTACTCGGGCGCCGGGCTGGCCGCCACCTACGCG
GGCGGCGCGGACGAGGACGAGCTGCGCGGGTTCTGGAAGCGCGCGGGCGAGCACCGCCCG
TTCGTCGCGCAGGGCAGCGCGTTCGCGGCGGAGGCCCGGCGGCGCGCCGGACTGGAGACG
CCGCACACGGAGATCGGGACGCGGGTCTTCTGCGACATGGACCCCGACCGGGCCGCGCAG
GTCTGCGTCGAGGCGCGGCCCGGACGCGAGGAGGCGCTGGAAGAGGACGGGGGCGCTCAG
CCCGCGTTCGAGGTGTGGCGGCGGCGCATCGCCGACGAGTTCGCAGCGAAGGGGAGGTGC
TAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR012964 Protein of unknown function DUF1702 (Family)
 [2-295]  7.30000000000007e-117 PF08012
PF08012   DUF1702
SignalP No significant hit
TMHMM No significant hit