close all open/close all

CDS information : Madu_00480


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction75,173 / 74,178 / - [in whole cluster]
75,173 / 74,178 / - [in contig]
Locationcomplement(74178..75173) [in whole cluster]
complement(74178..75173) [in contig]
TypeCDS
Length996 bp (331 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
GenemdpE2
Gene (GenBank)mdpE2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
Related Reference
ACC
Q6WS84
NITE
Madu_00470
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
ACC
Q84HJ1
NITE
Dynm_00150
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MSTLLGTLRRTVLAPSLDEVTFARRGFPSGPAGPATRKLEAIPQSVVCGFEWGIEVRGLA
ELERRLEFVTPELRGFAYEGATMACTIRDAMRAGRGHRTRDLLRGPGRPHIFLSYIGIGF
AMARLPRILWKSVLPDLPGAAYYPAMTWLAVDGYGFDLAYFHTDRWVGRQEVPATYPWEG
APDYFPRAVDQGIGRALWFICGGRAPEVAAAVRRFAAHRHADLWSGVGLAAAFAGGGTAE
GLAVLRREAGEHRPELAQGVVFAVKARSYAGHVPAHTGTTVAALADVTVDGAVALADDAE
AGTGRARPVPAYELWRGNVRAHFARLERAAG
selected fasta
>hypothetical protein [unknown]
ATGTCCACTCTCCTCGGAACTCTGCGCAGGACCGTGCTCGCCCCGTCCCTGGACGAGGTG
ACGTTCGCGCGGCGCGGCTTCCCCTCCGGGCCCGCGGGCCCGGCGACGCGGAAGCTGGAG
GCCATCCCGCAGTCGGTGGTCTGCGGCTTCGAGTGGGGCATCGAGGTCCGCGGTCTGGCG
GAGCTGGAGCGGCGGCTGGAGTTCGTGACGCCGGAGCTGCGGGGGTTCGCCTACGAGGGC
GCGACGATGGCCTGCACGATCCGCGACGCGATGCGCGCCGGGCGGGGGCACCGCACCCGC
GACCTCCTGCGGGGGCCGGGCCGTCCGCACATCTTCCTCTCCTACATCGGCATCGGGTTC
GCCATGGCGCGGCTGCCGCGGATCCTGTGGAAGAGCGTGCTGCCGGACCTGCCCGGCGCG
GCCTACTACCCGGCGATGACCTGGCTGGCGGTCGACGGCTACGGCTTCGACCTGGCCTAC
TTCCACACCGACCGGTGGGTGGGACGGCAGGAGGTGCCCGCCACCTACCCGTGGGAGGGC
GCGCCCGACTACTTCCCGCGCGCCGTCGACCAGGGGATCGGCCGGGCCCTGTGGTTCATC
TGCGGCGGCCGCGCGCCCGAGGTCGCCGCCGCCGTCCGCCGCTTCGCCGCGCACCGGCAC
GCCGACCTGTGGAGCGGGGTCGGCCTGGCCGCCGCGTTCGCCGGGGGCGGGACGGCCGAG
GGCCTGGCGGTGCTGCGCCGCGAGGCGGGCGAGCACCGGCCCGAGCTCGCGCAGGGCGTC
GTGTTCGCCGTCAAGGCACGCTCGTACGCCGGGCACGTGCCCGCGCACACCGGGACCACG
GTCGCCGCGCTCGCGGACGTGACCGTCGACGGGGCGGTCGCGCTGGCCGACGACGCCGAG
GCCGGTACCGGACGCGCGCGTCCGGTACCGGCCTACGAGCTGTGGCGGGGGAACGTGCGC
GCCCACTTCGCCCGCCTGGAGCGGGCCGCCGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR012964 Protein of unknown function DUF1702 (Family)
 [1-324]  1.60000000000002e-117 PF08012
PF08012   DUF1702
SignalP No significant hit
TMHMM No significant hit