close all open/close all

CDS information : Madu_00490


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction75,463 / 76,965 / + [in whole cluster]
75,463 / 76,965 / + [in contig]
Location75463..76965 [in whole cluster]
75463..76965 [in contig]
TypeCDS
Length1,503 bp (500 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative aldehyde dehydrogenase
Product (GenBank)aldehyde dehydrogenase
Gene
Gene (GenBank)
EC number1.2.1.-
Keyword
Note
  • It is supposed that this ORF is not involved in maduropeptin biosynthesis.
Note (GenBank)
  • mdp orf1
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q4VKV0
PmId
[15933032] Novel carotenoid oxidase involved in biosynthesis of 4,4'-diapolycopene dialdehyde. (Appl Environ Microbiol. , 2005)

close this sectionSequence

selected fasta
>putative aldehyde dehydrogenase [aldehyde dehydrogenase]
MSVATESNEKTFASLNPATEEVVAEYPIHDESAVAAAIDRAREASRWWGELGRRERRLRL
LNVKGALARNLNRMAEIIHQETGKPVADAQLETIMAISHLDWAARNAQKVLGPRTVFPGM
MAINQKCTLEYQPLGVVGVIGPWNYPIFTPIGSIAYALAAGNAVVFKPSEFTPGVGAYLA
ELVAGVVPEHPILQVVTGYGATGAALASSPHIGKLAFTGSAGTAKKVMAACAENLTPIVA
ECGGKDACIVDADADLDAAADAALWGAMSNAGQTCIGVERIYVVDRAYDAFLGKLTDKAR
ELRPGFDREAAYGPITMPGQLEIIERHIKDAIDRGGKAVVGGPESVRKPYVEPVVLTDVP
DDSSAVCEETFGPTITVHRVASLDEAVEKANRTAYGLAGTIFSGNKARAMEAARTMRSGM
TSINAFAAFAQVAALPFGGVGESGFGRIHGADGLREFARPKAITRQRFTTMNLTSFARSD
KEMARVLGLINMLHGKHYKR
selected fasta
>putative aldehyde dehydrogenase [aldehyde dehydrogenase]
ATGTCCGTGGCCACGGAGAGCAACGAGAAGACGTTCGCGTCACTGAACCCGGCGACCGAG
GAGGTCGTCGCCGAGTACCCGATCCACGACGAGTCCGCCGTGGCCGCCGCGATCGACCGG
GCCCGGGAGGCGTCGCGCTGGTGGGGCGAGCTGGGCCGGCGCGAGCGGCGGCTGCGGCTG
CTCAACGTCAAGGGCGCGCTCGCCCGCAACCTCAACCGGATGGCCGAGATCATCCACCAG
GAGACCGGCAAGCCGGTCGCCGACGCCCAGCTCGAGACGATCATGGCGATCTCGCACCTG
GACTGGGCGGCGCGCAACGCCCAGAAGGTGCTCGGGCCGCGCACCGTCTTCCCGGGCATG
ATGGCGATCAACCAGAAGTGCACGCTGGAGTACCAGCCGCTCGGCGTCGTCGGCGTCATC
GGCCCCTGGAACTACCCGATCTTCACCCCGATCGGCTCGATCGCGTACGCGCTCGCCGCC
GGGAACGCCGTCGTCTTCAAGCCGTCCGAGTTCACCCCGGGCGTCGGCGCCTACCTCGCC
GAACTCGTCGCCGGCGTCGTCCCCGAGCACCCGATCCTCCAGGTCGTGACCGGGTACGGC
GCGACGGGCGCGGCGCTCGCCTCGTCCCCCCACATCGGCAAGCTCGCGTTCACCGGCTCG
GCGGGCACCGCCAAGAAGGTGATGGCCGCGTGCGCCGAGAACCTCACCCCGATCGTGGCC
GAGTGCGGCGGCAAGGACGCCTGCATCGTCGACGCCGACGCCGACCTCGACGCCGCCGCC
GACGCCGCGCTGTGGGGCGCGATGTCCAACGCCGGGCAGACCTGCATCGGCGTCGAGCGG
ATCTACGTCGTCGACCGCGCCTACGACGCCTTCCTCGGCAAGCTCACCGACAAGGCCCGC
GAGCTGCGTCCCGGCTTCGACCGCGAGGCCGCCTACGGCCCGATCACGATGCCCGGCCAG
CTGGAGATCATCGAGCGGCACATCAAGGACGCCATCGACCGGGGCGGCAAGGCCGTCGTC
GGCGGGCCCGAGTCCGTCCGCAAGCCCTACGTGGAGCCGGTCGTCCTCACCGACGTCCCG
GACGACTCGTCCGCCGTCTGCGAGGAGACGTTCGGCCCGACGATCACCGTCCACCGCGTC
GCGTCGCTCGACGAGGCCGTCGAGAAGGCCAACCGCACCGCCTACGGCCTGGCCGGGACG
ATCTTCTCCGGCAACAAGGCCCGCGCGATGGAGGCGGCCCGCACGATGCGCTCCGGCATG
ACCTCGATCAACGCGTTCGCCGCGTTCGCGCAGGTCGCCGCGCTGCCGTTCGGCGGCGTC
GGGGAGTCGGGCTTCGGCCGCATCCACGGCGCGGACGGGCTGCGCGAGTTCGCCCGCCCG
AAAGCGATCACCCGGCAGCGGTTCACGACCATGAACCTGACGTCGTTCGCCCGCTCCGAC
AAGGAGATGGCGCGCGTCCTCGGCCTCATCAACATGCTGCACGGCAAGCACTACAAGAGG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR015590 Aldehyde dehydrogenase domain (Domain)
 [6-463]  PF00171
PF00171   Aldedh
IPR016160 Aldehyde dehydrogenase, conserved site (Conserved_site)
 [240-247]  PS00687
PS00687   ALDEHYDE_DEHYDR_GLU
IPR016161 Aldehyde/histidinol dehydrogenase (Domain)
 [10-466]  SSF53720
SSF53720   Aldehyde_DH/Histidinol_DH
IPR016162 Aldehyde dehydrogenase, N-terminal (Domain)
 [8-254]  5.20000000000001e-78 G3DSA:3.40.605.10
G3DSA:3.40.605.10   Aldehyde_dehydrogenase_N
IPR016163 Aldehyde dehydrogenase, C-terminal (Domain)
 [255-438]  1.5e-57 G3DSA:3.40.309.10
G3DSA:3.40.309.10   Aldehyde_dehydrogenase_C
SignalP No significant hit
TMHMM No significant hit