close all open/close all

CDS information : Madu_00500


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction76,968 / 77,456 / + [in whole cluster]
76,968 / 77,456 / + [in contig]
Location76968..77456 [in whole cluster]
76968..77456 [in contig]
TypeCDS
Length489 bp (162 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acetyltransferase
Product (GenBank)acetyltransferase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in maduropeptin biosynthesis.
Note (GenBank)
  • mdp orf2
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Family/Domain
FD
IPR000182

close this sectionSequence

selected fasta
>putative acetyltransferase [acetyltransferase]
MDGGPAPVRSGWRAPLRPAPPPPEGFRPFTRADLPALAALMWDAYRGTPDEGDVGGPDGA
LRELHRTLDGEYGTFLPGASFVAEPDGRPVAAALVTVYRDEPLLAFLFTAPSHAGRGLGH
ELVLAVMHVLAERGHDTLTLAVTRRNRRARLLYHRLGFVEVG
selected fasta
>putative acetyltransferase [acetyltransferase]
ATGGACGGCGGTCCCGCACCGGTGCGCAGCGGGTGGCGGGCTCCGCTGCGCCCGGCGCCG
CCGCCCCCGGAGGGCTTCCGCCCGTTCACGCGCGCCGACCTGCCCGCCCTCGCCGCCCTC
ATGTGGGACGCCTACCGGGGCACCCCCGACGAGGGCGACGTCGGCGGCCCCGACGGCGCG
CTGCGCGAGCTGCACCGGACGCTGGACGGCGAGTACGGGACGTTCCTGCCCGGCGCGTCG
TTCGTCGCCGAACCGGACGGCCGTCCCGTCGCCGCCGCCCTCGTGACCGTCTACCGGGAC
GAGCCGCTGCTCGCGTTCCTGTTCACCGCGCCGTCGCACGCGGGGCGGGGGCTCGGGCAC
GAACTCGTCCTGGCGGTCATGCACGTGCTCGCCGAGCGCGGCCACGACACCCTCACCCTC
GCGGTGACCAGGCGAAACCGCCGCGCCCGCCTCCTCTACCACCGCCTCGGCTTCGTCGAG
GTCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000182 GNAT domain (Domain)
 [24-162]  PS51186
PS51186   GNAT
 [84-158]  4.6e-13 PF00583
PF00583   Acetyltransf_1
IPR016181 Acyl-CoA N-acyltransferase (Domain)
 [23-162]  7.49999605851445e-26 SSF55729
SSF55729   Acyl_CoA_acyltransferase
 [26-162]  1e-22 G3DSA:3.40.630.30
G3DSA:3.40.630.30   Acyl_CoA_acyltransferase
SignalP No significant hit
TMHMM No significant hit