close all open/close all

CDS information : Madu_00510


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction79,386 / 77,809 / - [in whole cluster]
79,386 / 77,809 / - [in contig]
Locationcomplement(77809..79386) [in whole cluster]
complement(77809..79386) [in contig]
TypeCDS
Length1,578 bp (525 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)alcohol dehydrogenase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in maduropeptin biosynthesis.
Note (GenBank)
  • mdp rf3
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q00593
PmId
[1453953] DNA sequence determination and functional characterization of the OCT-plasmid-encoded alkJKL genes of Pseudomonas oleovorans. (Mol Microbiol. , 1992)
ACC
Q6UPE0
PmId
[12951056] Functional expression and processing of rat choline dehydrogenase precursor. (Biochem Biophys Res Commun. , 2003)

close this sectionSequence

selected fasta
>putative oxidoreductase [alcohol dehydrogenase]
MYDYIIVGAGSAGCVLAARLTEDPSVTVLLLEAGPPDDAPEIRIPAAVASLIKGPYDWDY
ATVPQEHAAGRSVYWPRGRTLGGSSSTNAMIYIPGSRHDYDTWRDEHGCVGWGYEDLLPY
FRGSQDQQRGETPYHGVGGPLRVEDLRFKHPLTQAWVKSAKAHGLAANPDFNGADQDGVG
FYQVTHKRGRRWSAADAYLHPNEYRPNLTVVTDALATRVLIEDGRAAGVAYEARGKSLTA
RANAEVVLSGGAVNSPQLLMLSGVGPADHLREHGIDVLVDSPVGRNLQDHPFVNVMFATP
RTKNLWEQANPLTFALHAALGRGPYASNVAEAGGFVRTAEGLPAPDLQYHVLPTPFIDQG
LVEPSQRLLSVMVTAIAVQSRGALTLRSANPHAKPLIDPAYLSAEADLDILVAGVKQARA
IADTGPLASLLGGEFAPGEQVSDDAAVVEFVRRECATLFHPTSTCAMGAVVDTELRVRGV
DGLRVVDASVMPSVPRGNTGAPTIAIAERASDLIRGRTPLKPANA
selected fasta
>putative oxidoreductase [alcohol dehydrogenase]
GTGTACGACTACATCATCGTGGGTGCGGGCAGCGCCGGATGCGTGCTGGCCGCCCGGCTG
ACCGAGGACCCGTCGGTCACGGTGCTGCTGCTGGAGGCGGGCCCGCCCGACGACGCCCCC
GAGATCCGCATTCCGGCCGCCGTCGCGTCGCTGATCAAGGGCCCGTACGACTGGGACTAC
GCGACCGTCCCGCAGGAGCACGCCGCCGGACGCAGCGTGTACTGGCCGCGCGGGCGGACG
CTCGGCGGCAGCTCGTCCACCAACGCGATGATCTACATTCCGGGGTCCCGGCACGACTAC
GACACCTGGCGGGACGAGCACGGCTGCGTCGGCTGGGGCTACGAGGACCTGCTGCCGTAC
TTCCGCGGCTCGCAGGACCAGCAGCGCGGCGAGACCCCGTACCACGGCGTCGGCGGCCCG
CTCCGCGTCGAGGACCTGCGGTTCAAGCACCCGCTCACGCAGGCGTGGGTGAAGTCGGCG
AAGGCGCACGGGCTCGCCGCCAATCCCGACTTCAACGGCGCCGACCAGGACGGCGTCGGC
TTCTACCAGGTCACGCACAAGCGCGGGCGCCGCTGGTCGGCGGCCGACGCGTACCTGCAC
CCGAACGAGTACCGCCCGAACCTGACCGTCGTCACCGACGCGCTCGCGACCCGCGTCCTG
ATCGAGGACGGACGCGCGGCGGGCGTGGCGTACGAGGCGCGCGGGAAGTCGCTGACCGCG
CGGGCGAACGCCGAGGTCGTCCTGTCCGGTGGGGCGGTGAACAGCCCGCAGCTCCTCATG
CTCTCGGGCGTCGGGCCCGCCGACCATCTCCGCGAGCACGGCATCGACGTGCTCGTCGAC
TCCCCGGTCGGCCGGAACCTGCAAGACCATCCGTTCGTGAACGTCATGTTCGCCACGCCC
CGGACCAAGAACCTCTGGGAGCAGGCCAACCCGCTCACGTTCGCGCTGCACGCCGCTCTG
GGGCGCGGCCCGTACGCGTCGAACGTCGCCGAGGCGGGCGGGTTCGTCCGGACGGCCGAG
GGGCTCCCCGCCCCGGACCTGCAGTACCACGTGCTGCCGACCCCGTTCATCGACCAGGGG
CTCGTCGAGCCGTCCCAGCGGCTCCTGTCGGTCATGGTCACGGCGATCGCGGTCCAGAGC
CGGGGCGCGCTCACGCTCCGGTCGGCGAACCCGCACGCCAAGCCGCTGATCGACCCCGCG
TACCTCTCCGCGGAGGCCGACCTCGACATTCTGGTGGCCGGGGTGAAGCAGGCCCGCGCG
ATCGCCGACACGGGTCCGCTCGCGTCCCTGCTCGGCGGCGAGTTCGCGCCCGGCGAGCAG
GTGTCCGACGACGCGGCGGTCGTCGAGTTCGTCCGCCGGGAGTGCGCGACGCTCTTCCAT
CCGACGAGCACGTGCGCGATGGGCGCGGTCGTGGACACCGAGTTGCGCGTGCGGGGGGTC
GACGGCCTGCGCGTGGTGGACGCGTCCGTCATGCCGTCGGTCCCGCGCGGCAACACGGGC
GCCCCGACGATCGCGATCGCCGAGCGGGCGTCCGATCTCATCCGCGGCAGGACCCCGCTC
AAGCCCGCGAACGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000172 Glucose-methanol-choline oxidoreductase, N-terminal (Domain)
 [2-291]  1.60000000000002e-93 PF00732
PF00732   GMC_oxred_N
 [251-265]  PS00624
PS00624   GMC_OXRED_2
IPR007867 Glucose-methanol-choline oxidoreductase, C-terminal (Domain)
 [379-510]  7.10000000000008e-41 PF05199
PF05199   GMC_oxred_C
IPR012132 Glucose-methanol-choline oxidoreductase (Family)
 [1-522]  PIRSF000137
PIRSF000137   Alcohol_oxidase
SignalP No significant hit
TMHMM No significant hit