close all open/close all

CDS information : Madu_00520


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction79,465 / 80,091 / + [in whole cluster]
79,465 / 80,091 / + [in contig]
Location79465..80091 [in whole cluster]
79465..80091 [in contig]
TypeCDS
Length627 bp (208 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in maduropeptin biosynthesis.
Note (GenBank)
  • mdp rf4
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MAKNRENPVVLSRIYTRTGDEGTTALGDTSRTRKTDPRLAAYADVEEANAAIGAALSLGS
LPADVAALLVRVQNEMFDVGADLCAPVVPDPEYPPLRIEPSYIERLEADCDEQNEKLRPL
RSFILPGGAPGAALLHVARTVARRAERTAWAAVEAHGTAAVGDPEAAEGGVNPLAVQYLN
RLSDLLFILCRVANAEHGDILWKPGGER
selected fasta
>hypothetical protein [unknown]
ATGGCGAAGAACAGGGAGAACCCCGTCGTCCTGTCCCGGATCTACACCCGTACGGGCGAT
GAAGGGACGACCGCGCTCGGCGACACGTCCCGCACCCGCAAGACCGACCCGCGCCTGGCC
GCCTACGCCGACGTGGAGGAGGCCAACGCCGCGATCGGCGCCGCGCTCTCCCTCGGCTCC
CTGCCCGCGGACGTCGCCGCGCTCCTCGTCCGCGTGCAGAACGAGATGTTCGACGTCGGC
GCGGACCTGTGCGCACCGGTCGTCCCGGATCCCGAGTACCCGCCCCTGCGCATCGAGCCG
TCCTACATCGAGCGGCTCGAGGCCGACTGCGACGAGCAGAACGAGAAGCTGCGGCCGCTG
CGCAGCTTCATCCTGCCGGGCGGGGCCCCCGGCGCCGCGCTGCTGCACGTCGCGCGGACC
GTCGCGCGGCGCGCCGAACGCACCGCGTGGGCGGCGGTCGAGGCGCACGGCACCGCCGCC
GTGGGCGACCCCGAGGCCGCCGAGGGCGGCGTCAACCCGCTGGCCGTCCAGTACCTCAAC
CGCCTGTCGGACCTGCTGTTCATCCTCTGCAGGGTCGCGAACGCCGAGCACGGCGACATC
CTGTGGAAGCCCGGCGGCGAGCGCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002779 Adenosylcobalamin biosynthesis, ATP:cob(I)alamin adenosyltransferase, EutT/PduO type (Domain)
 [14-194]  6.09999999999996e-52 PF01923
PF01923   Cob_adeno_trans
IPR016030 Adenosylcobalamin biosynthesis, ATP:cob(I)alamin adenosyltransferase-like (Domain)
 [12-204]  1.49999648196323e-52 SSF89028
SSF89028   AdoCbl_synth_CblAdoTrfase-like
 [23-207]  1.80000000000002e-57 G3DSA:1.20.1200.10
G3DSA:1.20.1200.10   AdoCbl_synth_CblAdoTrfase-like
IPR017858 Adenosylcobalamin biosynthesis, ATP:cob(I)alamin adenosyltransferase, PduO-type, N-terminal (Domain)
 [20-202]  PD007457
PD007457   AdoCbl_syn_CblAdoTrfase_PduO_N
 [15-198]  3.60000000000002e-44 TIGR00636
TIGR00636   PduO_Nterm
SignalP No significant hit
TMHMM No significant hit