close all open/close all
Madu_00520 Madu_00520   last last

CDS information : Madu_00530


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction81,719 / 80,148 / - [in whole cluster]
81,719 / 80,148 / - [in contig]
Locationcomplement(80148..81719) [in whole cluster]
complement(80148..81719) [in contig]
TypeCDS
Length1,572 bp (523 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative M28 family peptidase
Product (GenBank)predicted peptidase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in maduropeptin biosynthesis.
Note (GenBank)
  • mdp rf5
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q5QHG6
PmId
[15632434] Aminopeptidases and dipeptidyl-peptidases secreted by the dermatophyte Trichophyton rubrum. (Microbiology. , 2005)

close this sectionSequence

selected fasta
>putative M28 family peptidase [predicted peptidase]
MALPAATVFLLALSAVPPAGAAPAAPVALVGPGAAPDRPDLAELVTIEDVRRHLEAFQQI
GDYNGGNRASGTPGYEISVKYVVGRLRKAGFSPTVQKFTYPYWTERSVAVMSRAAGEGKG
KGKTKDKDKDKAYVAGLDFATMMYSGSGDVTARVIPVDVPAKGAEGTSGCEKADFKGFAK
GSIALMQRGKCTFETKAARARSAGAAAAIIYNKPGEKGPIDGTLDKPAKLPVVGASREVG
AELVKAAAKGGLTMRVKTDTEHGERSSSNVIVDTKQGRADNVVVVGAHLDSVQDGPGLND
NATGSAALLAVAEEIGALGEDGLRNRVRFAWWGAEEEGLHGSTHYVEKMDPSDRRNIAVN
LNFDMLGSPNGIRAVYDGDHSLGQGTTPPAGSAAIEKMFREYYRARDLPTAEAVFNGRSD
YGPFIDHDIPAGGLATGADGVKTAAEAKAYGGRAGKTYDPCYHAKCDRMKNVNMKLLDTN
VDGVAHVTQLLAASTVAVNGDARLLPAAVDAAGPLWSGGHLIR
selected fasta
>putative M28 family peptidase [predicted peptidase]
GTGGCGCTGCCCGCCGCGACCGTGTTCCTCCTGGCGCTGTCCGCCGTGCCGCCGGCCGGT
GCCGCTCCCGCCGCTCCGGTCGCGCTCGTCGGTCCGGGGGCGGCGCCCGACCGTCCCGAC
CTCGCCGAGCTGGTGACGATCGAGGACGTGCGGCGGCATCTGGAGGCGTTCCAGCAGATC
GGCGACTACAACGGCGGCAACCGCGCGTCCGGCACGCCCGGGTACGAGATCTCGGTGAAG
TACGTCGTCGGGCGGCTGCGCAAGGCGGGGTTCTCGCCGACCGTGCAGAAGTTCACCTAC
CCGTACTGGACGGAGCGTTCGGTCGCGGTGATGTCGCGAGCGGCAGGCGAGGGCAAGGGC
AAGGGCAAAACCAAGGACAAGGACAAGGACAAGGCGTACGTGGCGGGCCTGGACTTCGCC
ACGATGATGTACTCCGGTTCCGGGGACGTCACCGCCCGCGTGATCCCCGTGGACGTCCCG
GCCAAGGGCGCGGAGGGCACCAGCGGGTGCGAGAAGGCGGACTTCAAAGGCTTCGCCAAG
GGCTCGATCGCGCTGATGCAGCGCGGGAAGTGCACGTTCGAGACGAAGGCGGCGCGCGCG
CGGTCCGCCGGTGCGGCTGCGGCGATCATCTACAACAAGCCCGGTGAGAAGGGCCCGATC
GACGGGACGCTCGACAAGCCGGCGAAGCTGCCGGTGGTGGGCGCGAGCCGCGAGGTCGGC
GCCGAGCTGGTGAAGGCGGCGGCCAAGGGCGGCCTGACGATGCGGGTGAAGACCGACACC
GAGCACGGTGAGCGGTCGTCCAGCAACGTCATCGTCGACACGAAGCAGGGACGTGCCGAC
AACGTGGTGGTCGTGGGGGCGCACCTCGACAGCGTGCAGGACGGGCCGGGCCTCAACGAC
AACGCGACCGGGTCGGCCGCGCTGCTCGCGGTCGCGGAGGAGATCGGCGCGCTCGGCGAG
GACGGGCTGCGGAACCGGGTGCGGTTCGCCTGGTGGGGCGCCGAGGAGGAGGGGCTGCAC
GGTTCGACGCACTACGTCGAGAAGATGGACCCGTCCGACCGGCGGAACATCGCCGTGAAC
CTCAACTTCGACATGCTCGGCTCGCCGAACGGGATCCGCGCCGTGTACGACGGCGACCAC
TCGCTCGGCCAGGGCACCACCCCGCCGGCCGGTTCGGCGGCGATCGAGAAGATGTTCCGC
GAGTACTACAGGGCGCGCGACCTGCCGACCGCCGAGGCCGTCTTCAACGGGCGCTCGGAC
TACGGCCCGTTCATCGACCACGACATCCCGGCCGGGGGCCTCGCCACCGGTGCGGACGGC
GTCAAGACGGCGGCCGAGGCGAAGGCGTACGGGGGGCGCGCGGGCAAGACCTACGACCCG
TGCTACCACGCGAAGTGCGACCGGATGAAGAATGTGAACATGAAGCTGCTGGACACGAAC
GTCGACGGCGTCGCGCACGTCACGCAGTTGCTCGCGGCCAGCACGGTCGCGGTGAACGGC
GACGCCCGGCTGCTGCCGGCGGCGGTCGACGCGGCGGGCCCGCTGTGGAGCGGCGGTCAC
CTGATCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003137 Protease-associated domain, PA (Domain)
 [146-245]  1.3e-17 PF02225
PF02225   PA
IPR007484 Peptidase M28 (Domain)
 [281-475]  3.09999999999998e-36 PF04389
PF04389   Peptidase_M28
SignalP
 [1-21]  0.867 Signal
Eukaryota   
 [1-21]  0.849 Signal
Bacteria, Gram-positive   
 [1-21]  0.89 Signal
Bacteria, Gram-negative   
TMHMM No significant hit
Madu_00520 Madu_00520   last last