close all open/close all
first first   Medem_00020 Medem_00020

CDS information : Medem_00010


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction651 / 1 / - [in whole cluster]
651 / 1 / - [in contig]
Locationcomplement(1..651) [in whole cluster]
complement(1..651) [in contig]
TypeCDS
Length651 bp (216 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)sulfate adenylyltransferase
Gene
Gene (GenBank)ORF P
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in medermycin biosynthesis.
Note (GenBank)
  • GTG start codon
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)

close this sectionSequence

selected fasta
>[sulfate adenylyltransferase]
MTTVAHAHDTTDSPFALSHLDSLESEAVHIFREVAGEFERPVILFSGGKDSIVMLHLALK
AFAPAPVPFTLLHVDTGHNFPEVLAYRDRVVAEHGLRLHVASVQEYIDAGKLRERPDGTR
NPLQTVPLTEAIQQHRFDAVFGGGRRDEEKARAKERVFSLRDEFSQWDPRRQRPELWQLY
NGRHAPGEHVRVFPLSNWTELDVWQYIAREGIELPEI
selected fasta
>[sulfate adenylyltransferase]
GTGACCACCGTCGCCCATGCCCACGACACCACGGACAGTCCGTTCGCGCTGTCGCACCTC
GACTCCCTGGAGTCCGAGGCCGTCCACATCTTCCGTGAGGTGGCGGGCGAGTTCGAGCGG
CCGGTGATCCTCTTCTCCGGCGGCAAGGACTCCATCGTCATGCTGCACCTGGCGCTGAAG
GCCTTCGCCCCCGCGCCGGTCCCCTTCACGCTGCTGCACGTCGACACCGGGCACAACTTC
CCCGAGGTCCTCGCCTACCGCGACCGCGTCGTGGCCGAGCACGGGCTGCGGCTGCACGTC
GCCTCCGTGCAGGAGTACATCGACGCCGGCAAGCTCCGCGAGCGCCCCGACGGCACCCGC
AACCCGCTGCAGACCGTCCCGCTGACTGAGGCGATCCAGCAGCACCGCTTCGACGCCGTC
TTCGGCGGCGGCCGCCGCGACGAGGAGAAGGCCCGCGCCAAGGAGCGGGTGTTCTCGCTG
CGCGACGAGTTCTCGCAGTGGGACCCGCGGCGCCAGCGCCCCGAGCTGTGGCAGCTCTAC
AACGGCCGGCACGCCCCCGGCGAGCACGTCCGCGTCTTCCCGCTCTCCAACTGGACCGAG
CTGGACGTCTGGCAGTACATCGCCCGTGAGGGCATCGAGCTGCCGGAGATC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002500 Phosphoadenosine phosphosulphate reductase (Domain)
 [41-215]  1.9e-43 PF01507
PF01507   PAPS_reduct
IPR014729 Rossmann-like alpha/beta/alpha sandwich fold (Domain)
 [9-215]  1.2e-52 G3DSA:3.40.50.620
G3DSA:3.40.50.620   Rossmann-like_a/b/a_fold
SignalP
 [1-7]  0.067 Signal
Bacteria, Gram-negative   
TMHMM No significant hit
first first   Medem_00020 Medem_00020