close all open/close all

CDS information : Medem_00020


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction1,181 / 648 / - [in whole cluster]
1,181 / 648 / - [in contig]
Locationcomplement(648..1181) [in whole cluster]
complement(648..1181) [in contig]
TypeCDS
Length534 bp (177 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)adenylylsulfate kinase
Gene
Gene (GenBank)ORF Q
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in medermycin biosynthesis.
Note (GenBank)
  • GTG start codon
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)

close this sectionSequence

selected fasta
>[adenylylsulfate kinase]
MTGATIWLTGLPSAGKTTIAYELAGRLRDEGHAVEILDGDEIREFLSAGLGFTREDRHTN
VQRIGFVAELLASHGVKVLVPVIAPYNDSREAVRKRHQAEGTAFVEVHVATPVDVCSVRD
VKGLYAKQAAGEISGLTGVDDPYEAPENPDLRIESQNQTVQESAAQLHALLTERGLL
selected fasta
>[adenylylsulfate kinase]
GTGACCGGTGCCACCATCTGGCTCACCGGCCTGCCGAGCGCCGGGAAGACCACCATCGCG
TACGAGCTGGCCGGCCGCCTCCGCGACGAGGGCCACGCCGTCGAGATCCTCGACGGCGAC
GAGATCCGCGAGTTCCTCTCGGCGGGCCTCGGCTTCACCCGCGAGGACCGGCACACCAAC
GTGCAGCGGATCGGCTTCGTCGCCGAGCTGCTCGCCTCGCACGGCGTGAAGGTCCTGGTC
CCGGTCATCGCCCCGTACAACGACAGCCGCGAGGCGGTCCGCAAGCGCCACCAGGCCGAG
GGCACCGCCTTCGTCGAGGTGCACGTGGCCACCCCCGTGGACGTCTGCTCCGTCCGCGAC
GTGAAGGGCCTCTACGCCAAGCAGGCCGCGGGCGAGATCAGCGGCCTCACCGGCGTCGAC
GACCCGTACGAGGCGCCCGAGAACCCCGATCTGCGGATCGAGTCCCAGAACCAGACCGTG
CAGGAGTCCGCGGCGCAGCTCCACGCGCTGCTCACCGAGAGGGGTCTGCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002891 Adenylylsulphate kinase (Family)
 [3-169]  6.90000000000001e-58 TIGR00455
TIGR00455   ApsK
 [3-159]  5.40000000000002e-60 PF01583
PF01583   APS_kinase
SignalP No significant hit
TMHMM No significant hit