close all open/close all

CDS information : Medem_00030


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction1,918 / 1,211 / - [in whole cluster]
1,918 / 1,211 / - [in contig]
Locationcomplement(1211..1918) [in whole cluster]
complement(1211..1918) [in contig]
TypeCDS
Length708 bp (235 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)phosphoadenosine phosphosulfate reductase
Gene
Gene (GenBank)ORF R
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in medermycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)

close this sectionSequence

selected fasta
>[phosphoadenosine phosphosulfate reductase]
MTVTQDATAADLKALAEQAGRDLEDASALEILRWAVDTFGDRFCVTSSMEDAVVAHLASR
VRPGVDVVFLDTGYHFEETIGTRDAVDAVMDVNVITLTPLQTVAEQDAEHGPRLHDRDPD
LCCALRKVKPLEDGLTAYGAWATGLRRDESPTRANTPVVGWDEKRQKVKVSPIARWTQDD
VDAYVTEHGVLTNPLLMDGYASVGCAPCTRRVLEGEDARAGRWAGRAKTECGLHG
selected fasta
>[phosphoadenosine phosphosulfate reductase]
ATGACGGTCACTCAGGACGCGACCGCGGCCGACCTGAAGGCACTCGCCGAGCAGGCCGGC
CGTGATCTGGAGGACGCCTCCGCGCTGGAGATCCTCCGCTGGGCCGTGGACACCTTCGGC
GACCGCTTCTGCGTCACCTCCTCCATGGAGGACGCGGTCGTCGCCCACCTCGCCTCCCGG
GTCCGCCCCGGCGTGGACGTGGTCTTCCTCGACACGGGCTACCACTTCGAGGAGACCATC
GGCACCCGCGACGCCGTGGACGCCGTCATGGACGTCAACGTCATCACCCTGACCCCCCTT
CAGACGGTGGCCGAGCAGGACGCGGAGCACGGTCCGAGGCTCCACGACCGCGACCCCGAC
CTGTGCTGCGCGCTGCGCAAGGTCAAGCCGCTGGAGGACGGTCTCACCGCCTACGGCGCG
TGGGCCACCGGCCTGCGCCGCGACGAGTCCCCCACCCGGGCGAACACCCCGGTCGTCGGC
TGGGACGAGAAGCGGCAGAAGGTCAAGGTCTCCCCCATCGCCCGCTGGACGCAGGACGAC
GTCGACGCGTACGTCACGGAGCACGGCGTCCTCACCAACCCGCTCCTCATGGACGGGTAC
GCCTCGGTCGGCTGCGCCCCCTGCACCCGGCGCGTCCTGGAGGGCGAGGACGCCCGCGCC
GGACGCTGGGCCGGACGGGCCAAGACCGAATGCGGGCTGCACGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002500 Phosphoadenosine phosphosulphate reductase (Domain)
 [48-210]  8.30000000000004e-40 PF01507
PF01507   PAPS_reduct
IPR004511 Phosphoadenosine phosphosulphate/adenosine 5'-phosphosulphate reductase (Family)
 [1-235]  2.59998233910302e-123 PIRSF000857
PIRSF000857   PAPS_reductase
 [29-234]  3.40000000000004e-59 TIGR00434
TIGR00434   CysH
IPR014729 Rossmann-like alpha/beta/alpha sandwich fold (Domain)
 [16-207]  2.59999999999998e-56 G3DSA:3.40.50.620
G3DSA:3.40.50.620   Rossmann-like_a/b/a_fold
SignalP No significant hit
TMHMM No significant hit