close all open/close all

CDS information : Medem_00040


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction3,785 / 2,091 / - [in whole cluster]
3,785 / 2,091 / - [in contig]
Locationcomplement(2091..3785) [in whole cluster]
complement(2091..3785) [in contig]
TypeCDS
Length1,695 bp (564 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)nitrite/sulphite reductase
Gene
Gene (GenBank)ORF X
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in medermycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)

close this sectionSequence

selected fasta
>[nitrite/sulphite reductase]
MAATPENPTPAAARRKVGRHRGEGQWAVGHFTPLNGNEQFKKDDDGLNVRTRIETVYSKR
GFDSIDPNDLRGRMRWWGLYTQRKQGLDGTKTGVLEPEELDDEYFMLRVRIDGGRLTTEQ
LRVIGEISEEFARGTADITDRQNVQYHWIRIEDVPEIWNRLEAVGLSTTEACGDTPRVIL
GSPVAGIAADEIIDGTPAIEEIYRRIVGNKDFSNLPRKFKSAVSGSPLLDVAHEINDIAF
VGVEHPEHGPGFDVWVGGGLSTNPKLGVRLGTWVSLDEVPDVYEGVISIFRDYGYRRLRN
RARLKFLVADWGPEKFRQVLEDEYLNRKLTDGPAPEQPAGRWRDHVGVHRQKDGRFYVGF
APRVGRVDGATLTKIAGIAEEHGSGRVRTTAEQKMLVLDIEEAQVESIVAALEALDCGSP
PAFRRGTMACTGIEFCKLAIVETKGRGSSLIDELERRIPEFDEPLTININGCPNACARIQ
VADIGLKGQLVLDDDGNRVEGYQVHLGGALGLEAGFGRKVRGLKVTAAELPDYVERVLKR
FQAERETGERFATWTARASEESLS
selected fasta
>[nitrite/sulphite reductase]
ATGGCCGCCACCCCGGAAAACCCCACTCCCGCCGCCGCCCGACGCAAGGTCGGGCGCCAC
CGTGGCGAGGGTCAGTGGGCCGTGGGGCACTTCACCCCCCTGAACGGCAATGAGCAGTTC
AAGAAGGACGACGACGGTCTCAATGTACGGACACGTATTGAGACGGTCTACTCGAAGCGC
GGCTTCGACTCCATCGACCCCAACGACCTGCGCGGACGCATGCGCTGGTGGGGCCTCTAC
ACCCAGCGCAAGCAGGGTCTGGACGGCACCAAGACGGGTGTCCTGGAGCCGGAGGAGCTG
GACGACGAGTACTTCATGCTCCGCGTCCGCATCGACGGCGGCCGGCTGACCACCGAGCAG
CTCCGGGTCATCGGCGAGATCTCCGAGGAGTTCGCCCGCGGCACCGCCGACATCACGGAC
CGGCAGAACGTCCAGTACCACTGGATCCGCATCGAGGACGTCCCCGAGATCTGGAACCGC
CTGGAGGCGGTCGGCCTGTCGACCACCGAGGCCTGCGGCGACACCCCGCGCGTCATCCTC
GGCTCCCCCGTGGCCGGCATCGCCGCCGACGAGATCATCGACGGCACCCCCGCCATCGAG
GAGATCTACCGGCGGATCGTCGGCAACAAGGACTTCTCCAACCTGCCCCGCAAGTTCAAG
TCCGCGGTCTCCGGCTCGCCGCTGCTCGACGTGGCGCACGAGATCAACGACATCGCCTTC
GTCGGCGTGGAGCACCCGGAGCACGGCCCCGGCTTCGACGTGTGGGTCGGCGGCGGTCTG
TCCACCAACCCGAAGCTCGGCGTCCGCCTCGGCACCTGGGTCTCCCTCGACGAGGTCCCC
GACGTCTACGAGGGCGTCATCTCGATCTTCCGCGACTACGGCTACCGCCGGCTGCGCAAC
CGCGCCCGCCTGAAGTTCCTCGTCGCCGACTGGGGCCCGGAGAAGTTCCGCCAGGTCCTG
GAGGACGAGTACCTGAACCGCAAGCTGACGGACGGCCCCGCCCCCGAGCAGCCCGCGGGC
CGCTGGCGCGACCACGTCGGCGTCCACCGCCAGAAGGACGGACGGTTCTACGTCGGTTTC
GCGCCGCGCGTCGGCCGCGTCGACGGCGCCACCCTGACGAAGATCGCCGGGATCGCCGAG
GAGCACGGCTCCGGCCGGGTCCGCACCACCGCCGAGCAGAAGATGCTCGTCCTCGACATC
GAGGAGGCGCAGGTCGAGTCGATCGTCGCCGCCCTGGAGGCGCTGGACTGCGGGTCACCC
CCTGCGTTCCGGCGCGGCACGATGGCCTGCACCGGCATCGAGTTCTGCAAGCTCGCGATC
GTCGAGACGAAGGGCCGCGGCTCCTCGCTCATCGACGAACTGGAGCGGCGCATCCCCGAG
TTCGACGAGCCGCTGACGATCAACATCAACGGCTGCCCGAACGCCTGCGCCCGCATCCAG
GTGGCGGACATCGGTCTCAAGGGCCAGCTGGTCCTGGACGACGACGGCAACCGCGTCGAG
GGCTACCAGGTCCACCTGGGCGGCGCGCTCGGCCTGGAGGCAGGTTTCGGCCGCAAGGTC
CGCGGCCTCAAGGTCACGGCGGCCGAGCTCCCGGACTACGTGGAGCGGGTCCTCAAGCGC
TTCCAGGCGGAGCGCGAGACCGGCGAGCGCTTCGCGACCTGGACGGCCCGCGCGTCGGAG
GAGTCCCTGTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005117 Nitrite/sulphite reductase, hemoprotein beta-component, ferrodoxin-like (Domain)
 [101-169]  7.10000000000008e-52 G3DSA:3.90.480.10 [341-417]  7.10000000000008e-52 G3DSA:3.90.480.10
G3DSA:3.90.480.10   G3DSA:3.90.480.10
 [102-163]  1.9e-21 PF03460 [349-414]  7.79999999999999e-16 PF03460
PF03460   NIR_SIR_ferr
 [106-169]  1.39999892049878e-19 SSF55124 [346-422]  7.40000780398342e-13 SSF55124
SSF55124   NiR_SiRalpha_1/3
IPR006066 Nitrite/sulphite reductase iron-sulphur/siroheam-binding site (Binding_site)
 [425-443]  1.39999892049878e-09 PR00397 [470-488]  1.39999892049878e-09 PR00397
PR00397   SIROHAEM
 [470-486]  PS00365
PS00365   NIR_SIR
IPR006067 Nitrite/sulphite reductase 4Fe-4S domain (Domain)
 [173-328]  3.80000000000003e-36 PF01077 [424-558]  2.1e-13 PF01077
PF01077   NIR_SIR
SignalP No significant hit
TMHMM No significant hit