close all open/close all

CDS information : Medem_00050


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction4,718 / 4,149 / - [in whole cluster]
4,718 / 4,149 / - [in contig]
Locationcomplement(4149..4718) [in whole cluster]
complement(4149..4718) [in contig]
TypeCDS
Length570 bp (189 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)acetyltransferase
Gene
Gene (GenBank)ORF Y
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in medermycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)

close this sectionSequence

selected fasta
>[acetyltransferase]
MRITLTTWSLEQTSPSDLRPSPAPEGDDITIARAAVPSPEYSRFLYTAVGGDIRWNDRLP
LTYKEWEEIVEKPGAEIWVAYDRGTPAGYVELDPQPDGVVEIVYFGLIPAFRGRRIGGHL
LSFGTARAWDLAERWPDREATRRVWLHTCSLDGPHAMANYERRGFRLFDTKVEEVEESET
PGPWPGAHA
selected fasta
>[acetyltransferase]
ATGCGCATCACTCTCACCACCTGGTCCCTCGAACAGACCTCGCCGTCCGATCTCCGCCCC
TCCCCCGCCCCGGAGGGTGACGACATCACGATCGCGCGGGCCGCGGTCCCCTCGCCGGAG
TACAGCCGCTTCCTCTATACGGCGGTCGGCGGCGACATCCGCTGGAACGACCGCCTGCCG
CTCACGTACAAGGAGTGGGAGGAGATCGTCGAGAAGCCGGGGGCCGAGATCTGGGTGGCG
TACGACCGGGGGACGCCGGCCGGGTACGTGGAGCTCGACCCGCAGCCCGACGGCGTCGTC
GAGATCGTCTACTTCGGCCTGATCCCCGCCTTCCGCGGTCGCCGGATCGGCGGCCACCTC
CTCTCCTTCGGAACGGCGCGCGCCTGGGACCTGGCCGAGCGGTGGCCGGACCGGGAGGCC
ACGCGGCGCGTCTGGCTGCACACCTGCTCGCTCGACGGCCCGCACGCGATGGCCAACTAC
GAGCGGCGCGGATTCCGGCTCTTCGACACCAAGGTGGAGGAGGTCGAGGAGTCCGAGACC
CCCGGCCCGTGGCCCGGCGCCCACGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000182 GNAT domain (Domain)
 [74-166]  3.60000000000001e-09 PF13508
PF13508   Acetyltransf_7
 [29-182]  PS51186
PS51186   GNAT
IPR016181 Acyl-CoA N-acyltransferase (Domain)
 [60-170]  9.50000000000001e-15 G3DSA:3.40.630.30
G3DSA:3.40.630.30   Acyl_CoA_acyltransferase
 [24-170]  8.80000265836278e-18 SSF55729
SSF55729   Acyl_CoA_acyltransferase
SignalP No significant hit
TMHMM No significant hit