close all open/close all

CDS information : Medem_00060


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction5,000 / 5,680 / + [in whole cluster]
5,000 / 5,680 / + [in contig]
Location5000..5680 [in whole cluster]
5000..5680 [in contig]
TypeCDS
Length681 bp (226 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)repressor-response regulator
Gene
Gene (GenBank)med-ORF30
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Related Reference
ACC
Q56154
NITE
Jado_00050
PmId
[11733141] A repressor-response regulator gene pair controlling jadomycin B production in Streptomyces venezuelae ISP5230. (Gene. , 2001)
[19423672] Autoregulation of antibiotic biosynthesis by binding of the end product to an atypical response regulator. (Proc Natl Acad Sci U S A. , 2009)
[20562102] "Pseudo" gamma-butyrolactone receptors respond to antibiotic signals to coordinate antibiotic biosynthesis. (J Biol Chem. , 2010)
[23832247] JadR and jadR2 act synergistically to repress jadomycin biosynthesis. (Sci China Life Sci. , 2013)

close this sectionSequence

selected fasta
>putative transcriptional regulator [repressor-response regulator]
MRVLVVEDERDQAESLIDGLRRHGHDTIVAGSGAEALDAFENADLVLLDLGLPDIDGIEV
CRRMRAAGDTPIISFAGESAELDRILGLQAGSDDCLERPYSFRELMARIDAVMRRVGARI
GGQRRPTLSRGGLSLDSESREVVLDGRPIPLTRKEFDLLHYLASRPGVVVSRQRLMIDVW
GHPADVGLSAQASRTIDTHVSSMRSKLRESGWILTVRGVGFRFRQD
selected fasta
>putative transcriptional regulator [repressor-response regulator]
ATGCGCGTCCTTGTGGTCGAGGACGAACGAGATCAGGCAGAGTCGCTGATAGACGGCCTC
AGACGGCATGGGCACGACACAATTGTGGCCGGTTCGGGGGCCGAGGCCCTGGACGCATTC
GAGAATGCCGACCTCGTACTGCTCGATCTGGGGCTGCCCGATATCGACGGAATCGAAGTA
TGCCGTCGCATGCGGGCGGCAGGCGACACGCCCATCATATCCTTCGCCGGTGAGTCCGCC
GAGCTCGACAGGATTCTCGGACTGCAGGCGGGCTCGGACGACTGTCTCGAGCGGCCCTAT
TCTTTTCGGGAGCTGATGGCTCGAATCGACGCCGTCATGCGAAGGGTCGGCGCGCGAATC
GGGGGACAGCGCAGACCCACCCTCTCCCGCGGCGGCCTCAGTCTCGACAGCGAGTCCCGG
GAGGTCGTGCTCGACGGGCGGCCGATCCCGCTGACCCGCAAGGAGTTCGACCTCCTGCAC
TATCTCGCGAGCCGGCCGGGCGTCGTCGTCTCCCGGCAGCGTCTGATGATCGATGTCTGG
GGACATCCGGCCGACGTGGGACTCAGCGCGCAGGCGAGCCGGACGATCGACACCCATGTG
AGCTCCATGCGGAGCAAGCTGCGCGAGAGCGGCTGGATCCTGACCGTCCGAGGAGTGGGA
TTCCGGTTCCGCCAGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [1-109]  2.99998750445706e-35 SM00448
SM00448   REC
 [3-109]  1.2e-18 PF00072
PF00072   Response_reg
 [2-113]  PS50110
PS50110   RESPONSE_REGULATORY
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [146-223]  2.3e-21 PF00486
PF00486   Trans_reg_C
 [146-223]  6.19998763505952e-27 SM00862
SM00862   Trans_reg_C
IPR011006 CheY-like superfamily (Domain)
 [1-182]  2.49999811956465e-31 SSF52172
SSF52172   CheY_like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [123-225]  3.90000000000001e-29 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit