close all open/close all

CDS information : Medem_00070


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction6,358 / 5,738 / - [in whole cluster]
6,358 / 5,738 / - [in contig]
Locationcomplement(5738..6358) [in whole cluster]
complement(5738..6358) [in contig]
TypeCDS
Length621 bp (206 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative disulphide-forming protein
Gene
Gene (GenBank)med-ORF26
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)

close this sectionSequence

selected fasta
>hypothetical protein [putative disulphide-forming protein]
MRVEVYFDILCPWCYIGKKRLATALAGRDDVDLVWRSMELDPDGSPTAGPTAAEVIAQYQ
SGPEQAAARVRQIQSLGEAEGVRLDLHKARPVNSFDAHRLVHLGAAHGRADEVLERLLYG
YHTEGLDIAAPEVLEKLGVEAGLDPAAVRRVVEGTEFTEHVRADERRAVEAGVRGVPSLV
VDGGVPASAVQSPEALARLLTPRSRG
selected fasta
>hypothetical protein [putative disulphide-forming protein]
ATGAGGGTCGAGGTGTACTTCGACATCCTGTGCCCCTGGTGCTACATCGGGAAGAAGAGG
CTGGCGACCGCGCTCGCCGGACGCGACGACGTGGACCTCGTCTGGCGCAGCATGGAACTG
GACCCGGACGGCAGTCCGACGGCGGGCCCGACGGCCGCCGAGGTGATCGCCCAGTACCAG
AGCGGTCCCGAGCAGGCCGCCGCCCGGGTGCGGCAGATCCAGTCGCTCGGCGAGGCCGAG
GGGGTGCGGCTCGACCTCCACAAGGCGCGGCCGGTCAACTCCTTCGACGCGCACCGGCTC
GTCCACCTGGGCGCCGCGCACGGGCGGGCCGACGAGGTCCTCGAACGGCTGCTGTACGGC
TATCACACCGAGGGGCTCGACATCGCCGCCCCCGAGGTCCTGGAGAAGCTGGGGGTCGAG
GCGGGTCTCGACCCGGCCGCGGTCCGCCGGGTGGTGGAGGGCACGGAGTTCACGGAGCAT
GTGCGCGCCGACGAACGGCGTGCCGTGGAGGCGGGCGTCAGGGGAGTGCCGTCGCTGGTG
GTCGACGGCGGGGTGCCCGCCTCGGCCGTCCAGAGTCCGGAGGCCCTGGCCCGGCTGCTG
ACCCCCCGGTCGCGTGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001853 DSBA-like thioredoxin domain (Domain)
 [2-200]  6.40000000000004e-42 PF01323
PF01323   DSBA
IPR012336 Thioredoxin-like fold (Domain)
 [2-48]  4.3e-13 G3DSA:3.40.30.10 [163-201]  4.3e-13 G3DSA:3.40.30.10
G3DSA:3.40.30.10   Thioredoxin_fold
 [1-206]  2.90000354677981e-43 SSF52833
SSF52833   Thiordxn-like_fd
IPR023169 Protein disulphide isomerase, central domain (Domain)
 [62-162]  3.2e-17 G3DSA:1.10.472.60
G3DSA:1.10.472.60   G3DSA:1.10.472.60
SignalP No significant hit
TMHMM No significant hit