close all open/close all

CDS information : Medem_00080


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction7,951 / 6,374 / - [in whole cluster]
7,951 / 6,374 / - [in contig]
Locationcomplement(6374..7951) [in whole cluster]
complement(6374..7951) [in contig]
TypeCDS
Length1,578 bp (525 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)transmembrane transport protein
Gene
Gene (GenBank)med-ORF25
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Related Reference
ACC
A5H8A5
PmId
[17470656] Transferable resistance to aminoglycosides by methylation of G1405 in 16S rRNA and to hydrophilic fluoroquinolones by QepA-mediated efflux in Escherichia coli. (Antimicrob Agents Chemother. , 2007)
[17548499] New plasmid-mediated fluoroquinolone efflux pump, QepA, found in an Escherichia coli clinical isolate. (Antimicrob Agents Chemother. , 2007)
ACC
Q939A4
PmId
[12937892] Repressed multidrug resistance genes in Streptomyces lividans. (Arch Microbiol. , 2003)

close this sectionSequence

selected fasta
>putative drug resistance transporter [transmembrane transport protein]
MSTEARTPPERAGAREWTALAVLGVPAVLVMMNMSVLYLALPTLSRDLDPSGPQLLWITD
IYGFMVAGALITMGTLGDRIGHRRILLIGAVAFTAASVFAAYANSAGMLVAARAVQGVAA
ASLAPSSLSVIRNLFRDPAQRTLAITIWMMSFMGGGALGPLVGGVLLQYFWWGSVFLVAV
PTMLVLVLTVPFLVPEFRSSGTGRLDLISVAMSLVTPLAIVYGIKGIAADGPGLSSLGFI
VLGLVVGAAFVRRQRRLATPLLDLSLFRIPAFSISAGGMIVVGMLLFGTSLLTSQYLQLV
LGYAPLKAGLWQLPTAVGATVVRLWVSGLAARHQPAVLMSAGAAFAVLGPIMLTQVDGGP
GFLVAGSLLLFAGLTPFMALGTGLVVGAAPPERAGAASAISETGAELGGALGIATLGSVA
TAVYGGYMADHLPTGLPADLAGPAGETLPAALEAARGLGGELGTALADTARAAFTQSLHV
HALILIPLLLALSALTLTLRRRGERDAEDLPTADDRAAAPAPAAD
selected fasta
>putative drug resistance transporter [transmembrane transport protein]
ATGAGCACCGAGGCCCGCACACCGCCCGAGCGGGCCGGCGCCCGCGAATGGACCGCCCTC
GCGGTCCTGGGCGTCCCGGCCGTCCTGGTCATGATGAACATGTCGGTGCTCTATCTGGCG
CTCCCGACACTGAGCCGCGACCTGGACCCCAGCGGCCCCCAGCTGCTGTGGATCACGGAC
ATCTACGGCTTCATGGTCGCCGGCGCCCTCATCACGATGGGCACCCTCGGGGACCGCATC
GGCCACCGCCGGATCCTGCTGATCGGCGCCGTCGCCTTCACCGCCGCCTCGGTCTTCGCG
GCGTACGCGAACAGCGCGGGGATGCTCGTCGCCGCGCGCGCCGTCCAGGGCGTCGCGGCC
GCCTCCCTCGCGCCCTCCTCGCTCTCCGTGATCCGCAACCTCTTCCGGGATCCCGCCCAG
CGCACCCTGGCCATCACCATCTGGATGATGAGCTTCATGGGCGGCGGCGCGCTCGGCCCG
CTCGTCGGCGGCGTGCTCCTCCAGTACTTCTGGTGGGGCTCGGTCTTCCTCGTCGCGGTG
CCGACCATGCTGGTGCTGGTCCTCACCGTGCCGTTCCTGGTGCCGGAGTTCCGCTCGTCC
GGGACCGGCCGGCTGGATCTCATCAGCGTCGCGATGTCCCTGGTGACCCCGCTCGCGATC
GTGTACGGGATCAAGGGCATCGCGGCGGACGGCCCCGGGCTCTCCTCGCTGGGCTTCATC
GTGCTCGGCCTGGTCGTCGGCGCGGCCTTCGTACGGCGCCAACGGCGGCTCGCCACACCC
CTGCTCGACCTGTCCCTCTTCCGCATCCCGGCCTTCTCCATCTCGGCCGGAGGCATGATC
GTCGTCGGGATGCTCCTCTTCGGCACGAGCCTCCTCACCTCGCAGTACCTGCAACTGGTG
CTGGGCTACGCGCCGCTGAAGGCCGGACTCTGGCAGCTGCCGACCGCCGTGGGCGCCACC
GTCGTCCGCCTGTGGGTCTCCGGTCTGGCCGCCCGCCACCAGCCCGCCGTGCTGATGAGC
GCGGGAGCGGCCTTCGCCGTCCTCGGCCCGATCATGCTCACCCAGGTCGACGGGGGCCCC
GGCTTCCTGGTGGCCGGTTCCCTGCTCCTCTTCGCCGGCCTCACCCCGTTCATGGCCCTG
GGCACGGGCCTGGTCGTGGGCGCGGCTCCGCCCGAGCGGGCCGGCGCCGCCTCGGCCATC
TCCGAGACGGGCGCGGAGCTCGGCGGTGCGCTGGGCATCGCCACGCTGGGCAGTGTGGCC
ACCGCCGTCTACGGCGGCTACATGGCCGACCACCTGCCCACGGGCCTGCCCGCGGACCTC
GCCGGTCCCGCCGGCGAGACGCTGCCCGCGGCCCTGGAAGCCGCCCGGGGGCTCGGCGGG
GAACTGGGCACCGCGCTGGCGGACACCGCCCGCGCCGCGTTCACCCAGAGCCTCCATGTG
CACGCGCTCATCCTGATCCCCCTGCTGCTCGCCCTCTCGGCCCTCACCCTCACGCTGCGC
CGGCGCGGGGAGCGGGACGCGGAGGACCTGCCGACCGCCGACGACCGCGCCGCCGCTCCC
GCGCCGGCCGCCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [28-412]  2.50000000000001e-38 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-515]  6.4999795054176e-62 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [19-505]  PS50850
PS50850   MFS
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [19-41]  Transmembrane (i-o) [56-78]  Transmembrane (o-i) [85-104]  Transmembrane (i-o) [109-131]  Transmembrane (o-i) [144-166]  Transmembrane (i-o) [172-194]  Transmembrane (o-i) [207-229]  Transmembrane (i-o) [234-251]  Transmembrane (o-i) [271-293]  Transmembrane (i-o) [308-330]  Transmembrane (o-i) [337-354]  Transmembrane (i-o) [364-386]  Transmembrane (o-i) [407-429]  Transmembrane (i-o) [477-499]  Transmembrane (o-i)
Transmembrane 14