close all open/close all

CDS information : Medem_00100


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction9,056 / 9,697 / + [in whole cluster]
9,056 / 9,697 / + [in contig]
Location9056..9697 [in whole cluster]
9056..9697 [in contig]
TypeCDS
Length642 bp (213 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)Tet-R family transcriptional regulator
Gene
Gene (GenBank)med-ORF28
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Family/Domain
FD
IPR001647

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [Tet-R family transcriptional regulator]
MARRAPRYAEAERNDRALLEAAKKVLAVDGAHTSVATIAARAGVGIASLYRRYRTKEELF
QHLCALSLGQWIQAVEEGLAHDDPWEGLVHYITAAIEFSGGALGPLAGTIPVTDEMAEKF
TRSEELTRSLIARAHEAGVLRADATAVDVSLLIEQLGKSSLVEQFEVQGRADLVDEASNA
RRRIIAIAVDGLRAGHGPLPGRPPGPDLLAERW
selected fasta
>putative TetR family transcriptional regulator [Tet-R family transcriptional regulator]
ATGGCCCGACGAGCTCCCCGATACGCCGAAGCGGAACGCAACGACCGCGCCCTCCTGGAG
GCAGCCAAGAAGGTCCTCGCCGTGGACGGCGCCCATACGTCCGTGGCGACGATCGCGGCG
CGCGCGGGAGTCGGCATCGCCAGCCTCTACCGGCGGTACCGCACCAAGGAGGAGCTGTTC
CAGCACCTGTGCGCCCTGTCGCTCGGGCAGTGGATCCAGGCGGTGGAGGAGGGGCTCGCG
CACGACGACCCCTGGGAGGGGCTCGTCCACTACATCACCGCCGCCATCGAGTTCAGTGGC
GGTGCGCTCGGCCCGCTGGCCGGCACGATCCCCGTCACCGACGAGATGGCCGAGAAGTTC
ACCCGGTCCGAGGAGCTGACGCGGTCCCTGATCGCGCGCGCCCACGAGGCGGGGGTGCTC
CGGGCGGACGCCACGGCCGTGGACGTCTCCCTCCTCATCGAGCAGCTCGGGAAGTCCTCC
CTGGTCGAGCAGTTCGAGGTCCAGGGCAGGGCCGACCTCGTCGACGAGGCGAGCAACGCC
CGCCGCCGCATCATCGCCATCGCGGTCGACGGGCTCCGCGCCGGGCACGGTCCGCTCCCG
GGCCGGCCGCCCGGCCCCGACCTCCTCGCCGAACGCTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [18-31]  1.60000065022528e-06 PR00455 [38-61]  1.60000065022528e-06 PR00455
PR00455   HTHTETR
 [18-62]  4.70000000000001e-11 PF00440
PF00440   TetR_N
 [12-71]  PS50977
PS50977   HTH_TETR_2
IPR009057 Homeodomain-like (Domain)
 [2-89]  6.20000124972815e-16 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [83-195]  9.39999974783881e-06 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [9-197]  4.10000000000001e-27 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP No significant hit
TMHMM No significant hit