close all open/close all

CDS information : Medem_00110


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction10,785 / 9,739 / - [in whole cluster]
10,785 / 9,739 / - [in contig]
Locationcomplement(9739..10785) [in whole cluster]
complement(9739..10785) [in contig]
TypeCDS
Length1,047 bp (348 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)med-ORF27
EC number
Keyword
Note
Note (GenBank)
  • TTG start codon
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MNSRETRTVRSHPCAGAGCRRRRETETGRGRRAAAGTSLCPDCQGELLTNLRRLPPLYRA
CGQLLDGSRNVSGPRERTSGGGLPGLPFNTAASDARREALAVLGSWAGLIAEARRLPRPD
RTVEALTAFLIRHSGWLTAHSAAGDASRELSEVTRRAARVATPDDQRRLVTVGACPEPGC
AGRLQSLIRPDAAGAAPAVRCRTDPAHHWAGEELMLLRRRLAAKAGTAQPPGAARPASPR
PASPGTAHPAAPDGATPPASRAQGSSAPSGGGEADTVRIVWLSASDITRLWGTPSGSVYR
LASQRAWRRRSRDGRTYYHEADVVRALSERHPRPVLTAPAGPRPPARR
selected fasta
>hypothetical protein [unknown]
TTGAATTCCCGCGAGACTCGAACGGTCCGGTCTCACCCCTGCGCGGGCGCCGGCTGTCGC
CGCCGGCGCGAGACGGAGACGGGACGCGGGCGGAGAGCGGCCGCCGGGACCTCCCTCTGT
CCGGACTGCCAGGGCGAACTCCTCACGAACCTCCGCCGGCTGCCCCCGCTCTACCGGGCC
TGCGGCCAACTGCTCGACGGCAGCCGGAACGTGAGCGGTCCGCGCGAGCGCACCTCCGGC
GGCGGGTTACCCGGACTCCCCTTCAACACGGCCGCGTCGGACGCGCGCCGGGAGGCCCTC
GCGGTCCTCGGCTCTTGGGCGGGCCTGATCGCGGAGGCCCGGCGACTGCCCCGACCCGAC
CGCACGGTGGAGGCCCTGACGGCCTTCCTGATACGCCACTCGGGCTGGCTGACCGCGCAC
AGCGCCGCCGGGGACGCCTCCCGCGAGCTGAGCGAGGTGACCCGCCGGGCGGCACGCGTC
GCCACCCCGGACGACCAGCGCCGCCTGGTGACGGTCGGCGCCTGCCCCGAGCCGGGCTGC
GCGGGGAGGCTCCAGTCGCTGATCCGGCCGGACGCCGCCGGCGCCGCCCCCGCCGTGCGG
TGCCGGACCGATCCGGCGCACCACTGGGCGGGCGAGGAACTGATGCTGCTCAGGCGGCGG
TTGGCGGCGAAGGCCGGGACGGCGCAGCCTCCGGGCGCGGCCCGTCCGGCTTCCCCGCGC
CCTGCGTCCCCGGGGACGGCACACCCGGCCGCGCCGGACGGAGCGACCCCGCCGGCGTCC
CGCGCGCAGGGGAGCTCCGCCCCGTCCGGAGGCGGGGAGGCGGACACGGTGCGGATCGTG
TGGCTCAGCGCCTCCGACATCACCCGGCTCTGGGGCACGCCGTCCGGCAGCGTCTACCGG
CTCGCCAGCCAGCGGGCGTGGCGGCGCCGGAGCCGGGACGGCCGCACGTACTACCACGAG
GCCGATGTCGTACGGGCGTTGAGCGAGCGGCACCCCCGGCCCGTGCTGACGGCGCCCGCC
GGCCCCCGCCCTCCGGCCCGTCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit