close all open/close all

CDS information : Medem_00120


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction11,211 / 11,486 / + [in whole cluster]
11,211 / 11,486 / + [in contig]
Location11211..11486 [in whole cluster]
11211..11486 [in contig]
TypeCDS
Length276 bp (91 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)acyl carrier protein (ACP)
Gene
Gene (GenBank)med-ORF23
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Related Reference
ACC
Q56165
NITE
Jado_00100
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionPKS/NRPS Module

ACP9..82

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [acyl carrier protein (ACP)]
MSSGIKTFELDDLKRILKEGVGADESVDLEGDILDVDFEALGYESLAMLETGTRIEREFG
VVLTDETLTETATPRRLIEAVNVQLRSVPTV
selected fasta
>polyketide synthase acyl carrier protein subunit [acyl carrier protein (ACP)]
ATGTCTTCCGGAATCAAGACCTTCGAACTCGATGATCTGAAGCGAATTCTCAAGGAAGGG
GTCGGCGCCGACGAAAGCGTCGACCTGGAAGGTGACATACTCGACGTGGATTTCGAAGCG
CTCGGATATGAATCCCTGGCGATGCTGGAGACGGGCACCCGCATTGAGCGCGAGTTCGGT
GTGGTCCTCACGGACGAGACGCTCACCGAGACCGCCACGCCGCGCCGGCTGATCGAGGCC
GTGAACGTCCAGCTGCGTTCCGTCCCCACCGTCTGA
ACP9..82
ACP25..246

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [40-55]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [10-85]  4.80000000000001e-14 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [9-82]  PS50075
PS50075   ACP_DOMAIN
 [13-81]  7e-09 PF00550
PF00550   PP-binding
 [5-85]  8.1000073432326e-12 SSF47336
SSF47336   ACP_like
SignalP
 [1-23]  0.038 Signal
Eukaryota   
TMHMM No significant hit