close all open/close all

CDS information : Medem_00130


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction11,536 / 12,252 / + [in whole cluster]
11,536 / 12,252 / + [in contig]
Location11536..12252 [in whole cluster]
11536..12252 [in contig]
TypeCDS
Length717 bp (238 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative phosphopantetheinyl transferase
Product (GenBank)phosphopantetheinyl transferase
Gene
Gene (GenBank)med-ORF24
EC number
Keyword
Note
Note (GenBank)
  • GTG start codon
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Related Reference
ACC
Q9L7M4
NITE
Jado_00180
PmId
[11390684] Cloning and functional analysis of a phosphopantetheinyl transferase superfamily gene associated with jadomycin biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 2001)
ACC
Q9RFL1
NITE
Myxo_00010
PmId
[10601310] New lessons for combinatorial biosynthesis from myxobacteria. The myxothiazol biosynthetic gene cluster of Stigmatella aurantiaca DW4/3-1. (J Biol Chem. , 1999)
[11134965] The mtaA gene of the myxothiazol biosynthetic gene cluster from Stigmatella aurantiaca DW4/3-1 encodes a phosphopantetheinyl transferase that activates polyketide synthases and polypeptide synthetases. (J Biochem. , 2001)
Family/Domain
FD
IPR008278

close this sectionSequence

selected fasta
>putative phosphopantetheinyl transferase [phosphopantetheinyl transferase]
MTRVRLDVWLVRTNETRPDTAALALEELDGRERERAERFVAPGDRLRYLAAHIALRRVLA
LHTGTAPGDLRFTRATCPRCGGPHGRPELAVGTPPVHFSLSHSHGRVLIAVAAAPVGADI
QRSPGGGTVEACLPALHPAERAEVERRPASARPAEFGRLWTRKEAYLKGIGTGLAHGMST
EYLGTDARGRPPGWTVLDLDLAEDPAYAAAVAVRAEGVRPPEVRERGASFLRAAVPAV
selected fasta
>putative phosphopantetheinyl transferase [phosphopantetheinyl transferase]
GTGACGCGGGTCCGGCTCGACGTCTGGCTGGTGCGGACGAACGAGACGCGGCCGGACACC
GCGGCCCTGGCCCTGGAGGAGCTGGACGGCCGGGAGCGGGAGCGGGCCGAACGGTTCGTC
GCCCCGGGCGACCGGCTCCGCTACCTCGCCGCCCACATCGCGCTCCGCCGGGTCCTGGCG
CTGCACACCGGGACGGCCCCGGGGGACCTGCGGTTCACCCGGGCCACCTGCCCCCGGTGC
GGCGGCCCGCACGGCCGTCCCGAACTGGCGGTGGGCACACCGCCCGTCCACTTCTCCCTC
TCCCACAGCCACGGACGGGTGCTCATCGCCGTCGCCGCCGCCCCGGTGGGAGCCGACATC
CAGCGCTCACCGGGCGGCGGCACCGTCGAAGCGTGCCTCCCGGCACTCCACCCGGCCGAG
CGGGCCGAGGTGGAGCGCCGTCCCGCGAGCGCCCGGCCGGCCGAGTTCGGCCGGCTCTGG
ACCCGTAAGGAGGCCTATCTCAAGGGAATCGGCACGGGCCTGGCGCACGGCATGTCCACC
GAGTACCTGGGGACCGACGCCCGCGGCAGGCCGCCCGGCTGGACGGTCCTCGACCTCGAT
CTCGCCGAGGACCCCGCGTACGCGGCGGCCGTGGCCGTACGTGCCGAAGGGGTCCGGCCG
CCGGAGGTGCGGGAGCGCGGCGCCTCCTTCCTCAGGGCCGCCGTCCCCGCCGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008278 4'-phosphopantetheinyl transferase (Domain)
 [6-120]  1e-27 SSF56214 [114-235]  1.70000295590054e-20 SSF56214
SSF56214   4-PPT_transf
 [135-213]  5.6e-10 G3DSA:3.90.470.20
G3DSA:3.90.470.20   G3DSA:3.90.470.20
 [116-185]  1.1e-06 PF01648
PF01648   ACPS
SignalP No significant hit
TMHMM No significant hit