close all open/close all

CDS information : Medem_00140


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction12,287 / 13,903 / + [in whole cluster]
12,287 / 13,903 / + [in contig]
Location12287..13903 [in whole cluster]
12287..13903 [in contig]
TypeCDS
Length1,617 bp (538 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acyl-CoA carboxylase beta subunit
Product (GenBank)decarboxylase
Gene
Gene (GenBank)med-ORF22
EC number
Keyword
Note
Note (GenBank)
  • GTG start codon
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Related Reference
ACC
O86517
PmId
[11526020] Role of an essential acyl coenzyme A carboxylase in the primary and secondary metabolism of Streptomyces coelicolor A3(2). (Appl Environ Microbiol. , 2001)
[12048195] Kinetic and structural analysis of a new group of Acyl-CoA carboxylases found in Streptomyces coelicolor A3(2). (J Biol Chem. , 2002)
ACC
Q9X4K7
PmId
[10589718] Genetic and biochemical characterization of the alpha and beta components of a propionyl-CoA carboxylase complex of Streptomyces coelicolor A3(2). (Microbiology. , 1999)
[12048195] Kinetic and structural analysis of a new group of Acyl-CoA carboxylases found in Streptomyces coelicolor A3(2). (J Biol Chem. , 2002)

close this sectionSequence

selected fasta
>putative acyl-CoA carboxylase beta subunit [decarboxylase]
MPTTESRPSTTDNPDDRTDRTDRSVSALRDELHVLRERALRGPSERATEAQHAKGKLTAR
ERIELLLDPGSFNEVEQLRRHRAQGFGLEARKPYTDGVITGWGTVEGRTVFVYAHDFRIF
GGALGEAHATKIHKIMDMAIAAGAPLVSLNDGAGARIQEGVSALAGYGGIFQRNTRASGV
IPQISVMLGPCAGGAAYSPALTDFVFMVRETSQMFITGPDVVKAVTGEEITQNGLGGADV
HAETSGVAHFAYDDEETCIAEVRYLLSMLPQNNRENPPAVVPDDSPDRATPALLDLVPAD
AVRSYDVRAVIEELVDDEEHMEVHSGWAANLVCTLARLDGRVVGIVANQPSVMAGVLDID
ASEKGARFVQMCDAFSIPIVTLVDVPGFLPGVGQEHHGVIRRGAKLLYAYCNATVPRISV
ILRKAYGGAYIVMDSQSIGADLTYAWPTNEIAVMGAEGAANVIFRRQIAEAPDPEAERLQ
KIKEYRTELMHPYYAVERGLVDDVIDPSDTRRVLVRGLEMLRAKHAELPSRKHGNPPQ
selected fasta
>putative acyl-CoA carboxylase beta subunit [decarboxylase]
GTGCCGACGACAGAGAGCCGACCATCGACCACCGACAACCCCGACGACAGGACCGACAGG
ACCGACCGCTCCGTCTCCGCTCTCCGTGACGAGCTGCACGTCCTGCGCGAGCGGGCGCTG
CGTGGCCCGAGTGAGCGCGCGACCGAGGCGCAGCACGCGAAGGGCAAGCTGACGGCGCGT
GAGCGCATCGAGCTGCTGCTCGACCCGGGTTCCTTCAACGAGGTCGAGCAGTTGCGCCGG
CACCGCGCCCAGGGCTTCGGCCTGGAGGCGAGGAAGCCGTACACCGACGGTGTGATCACC
GGCTGGGGCACGGTCGAGGGCCGGACGGTCTTCGTGTACGCGCACGACTTCCGGATCTTC
GGCGGTGCGCTGGGCGAGGCCCACGCGACGAAGATCCACAAGATCATGGACATGGCCATC
GCGGCCGGTGCCCCGCTGGTCTCGCTGAACGACGGCGCCGGTGCCCGTATCCAGGAGGGC
GTCTCCGCGCTCGCCGGCTACGGCGGCATCTTCCAGCGCAACACCCGGGCCTCGGGTGTC
ATCCCGCAGATCTCGGTGATGCTCGGCCCGTGCGCCGGCGGCGCGGCCTACAGCCCCGCC
CTCACCGACTTCGTGTTCATGGTCCGTGAGACCTCGCAGATGTTCATCACCGGCCCGGAC
GTCGTCAAGGCGGTCACCGGTGAGGAGATCACCCAGAACGGCCTCGGCGGCGCGGACGTG
CACGCCGAGACCTCGGGCGTCGCGCACTTCGCGTACGACGACGAGGAGACCTGCATCGCC
GAGGTCCGCTACCTCCTGTCGATGCTCCCGCAGAACAACCGCGAGAACCCGCCCGCCGTC
GTACCGGACGACTCCCCGGACCGTGCCACCCCCGCCCTCCTCGACCTGGTGCCCGCAGAC
GCCGTCCGCTCGTACGACGTCCGGGCCGTGATCGAGGAACTCGTCGACGACGAGGAGCAC
ATGGAGGTGCACAGCGGCTGGGCCGCCAACCTGGTGTGCACCCTCGCCCGGCTGGACGGC
CGGGTCGTCGGCATCGTCGCCAACCAGCCCTCCGTGATGGCGGGCGTCCTGGACATCGAC
GCCTCCGAGAAGGGGGCCCGCTTCGTGCAGATGTGCGACGCCTTCAGCATCCCGATCGTC
ACGCTCGTCGACGTACCGGGATTCCTCCCCGGCGTCGGCCAGGAGCACCACGGCGTCATC
AGAAGGGGCGCCAAGCTGCTCTACGCCTACTGCAACGCGACCGTGCCCCGGATCTCCGTG
ATCCTGCGCAAGGCCTACGGCGGCGCCTACATCGTCATGGACTCCCAGTCCATCGGCGCC
GACCTCACCTACGCCTGGCCCACCAACGAGATCGCGGTCATGGGCGCCGAGGGCGCCGCC
AACGTCATCTTCCGCCGGCAGATCGCGGAGGCCCCGGACCCCGAGGCGGAACGCCTGCAG
AAGATCAAGGAGTACAGGACCGAACTGATGCATCCCTACTACGCCGTCGAGCGCGGCCTC
GTCGACGATGTCATCGACCCCTCCGACACACGCCGGGTGCTCGTCCGCGGACTGGAGATG
CTCCGCGCCAAGCACGCCGAACTCCCCTCGCGCAAACACGGAAACCCGCCGCAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000022 Carboxyl transferase (Domain)
 [50-535]  PF01039
PF01039   Carboxyl_trans
IPR011762 Acetyl-coenzyme A carboxyltransferase, N-terminal (Domain)
 [31-245]  PS50980
PS50980   COA_CT_NTER
IPR011763 Acetyl-coenzyme A carboxyltransferase, C-terminal (Domain)
 [246-530]  PS50989
PS50989   COA_CT_CTER
SignalP No significant hit
TMHMM No significant hit