close all open/close all

CDS information : Medem_00150


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction13,942 / 14,898 / + [in whole cluster]
13,942 / 14,898 / + [in contig]
Location13942..14898 [in whole cluster]
13942..14898 [in contig]
TypeCDS
Length957 bp (318 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)first ring aromatase (ARO)
Gene
Gene (GenBank)med-ORF19
EC number
Keyword
  • 1st ring
Note
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Related Reference
ACC
Q54221
NITE
Griseu_00050
PmId
[8169211] Cloning, sequencing, and analysis of the griseusin polyketide synthase gene cluster from Streptomyces griseus. (J Bacteriol. , 1994)
[9195917] Domain analysis of the molecular recognition features of aromatic polyketide synthase subunits. (J Biol Chem. , 1997)
[10467128] Heterologous expression, purification, reconstitution and kinetic analysis of an extended type II polyketide synthase. (Chem Biol. , 1999)
ACC
Q56167
NITE
Jado_00120
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [first ring aromatase (ARO)]
MTQPTPRETAHEITVRATAERLYELIADVGGWPSIFPPSVHADHLERGDKEERIRLWATV
DGQVKHWTSRRTLDRAGLRVDFRQEVPSPPMAAMGGAWIIEPTGPGECRVRLLHDFRAVG
DDPGTLDWIDRAVDANSRSELAALKRHAERGADGPGEGDTFLTFEDTVRLEGHVKDVYDF
IDQAQHWADRLPHVTSVNLRDAGPGRQILAMDTLTKDGSPHTTESVRVCVPYERIVYKQT
TLPPLMALHTGEWSFAEDGAGATVVTSRHTAVVEPAAVTRVLGETADLPAARRYLREALG
ANSLATLRHAGEYAAARR
selected fasta
>putative cyclase/dehydratase [first ring aromatase (ARO)]
ATGACCCAGCCCACCCCACGGGAGACCGCCCACGAGATCACCGTCCGCGCGACGGCCGAG
CGGCTCTACGAACTGATCGCCGACGTCGGCGGCTGGCCCTCGATCTTCCCGCCCTCGGTC
CACGCCGACCACCTGGAGCGCGGCGACAAGGAGGAGCGCATCCGGCTCTGGGCCACCGTC
GACGGGCAGGTCAAGCACTGGACGTCCCGGCGCACCCTGGACCGCGCAGGACTCCGCGTC
GACTTCCGGCAGGAGGTGCCGAGTCCGCCGATGGCCGCGATGGGCGGTGCCTGGATCATC
GAACCCACGGGACCGGGGGAGTGCCGCGTACGGCTGCTGCACGACTTCCGGGCCGTCGGC
GACGACCCCGGGACCCTCGACTGGATCGACCGCGCCGTGGACGCCAACAGCCGGTCGGAG
CTCGCCGCCCTCAAGCGCCACGCCGAACGCGGCGCCGACGGCCCGGGCGAGGGCGACACC
TTCCTCACCTTCGAGGACACCGTCCGCCTCGAAGGCCACGTCAAGGACGTCTACGACTTC
ATCGACCAGGCCCAGCACTGGGCCGACCGCCTGCCCCACGTCACGTCCGTGAACCTGCGG
GACGCCGGCCCCGGCCGTCAGATCCTGGCCATGGACACGCTCACCAAGGACGGCAGCCCG
CACACCACCGAGTCGGTGCGCGTCTGCGTCCCGTACGAGCGGATCGTCTACAAGCAGACC
ACCCTGCCCCCGCTGATGGCCCTGCACACCGGCGAGTGGAGCTTCGCGGAGGACGGCGCC
GGCGCCACCGTCGTCACCTCGCGCCACACCGCCGTGGTCGAGCCCGCCGCCGTCACCCGG
GTCCTCGGCGAGACCGCCGACCTGCCGGCGGCGCGTCGCTACCTCCGCGAGGCGCTGGGT
GCGAACAGCCTGGCCACGCTGAGGCACGCCGGAGAGTACGCCGCGGCCCGCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [10-149]  1e-12 PF10604 [163-308]  3.90000000000001e-09 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [11-117]  2.2e-18 G3DSA:3.30.530.20 [164-268]  2.2e-18 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP
 [1-42]  0.092 Signal
Bacteria, Gram-negative   
 [1-42]  0.061 Signal
Eukaryota   
TMHMM No significant hit