close all open/close all

CDS information : Medem_00160


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction14,936 / 16,066 / + [in whole cluster]
14,936 / 16,066 / + [in contig]
Location14936..16066 [in whole cluster]
14936..16066 [in contig]
TypeCDS
Length1,131 bp (376 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 aminotransferase
Product (GenBank)NDP-deoxyhexose 3-aminotransferase
Gene
Gene (GenBank)med-ORF20
EC number2.6.1.-
Keyword
  • angolosamine
Note
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Related Reference
ACC
Q2PC67
NITE
Rubra_00230
PmId
[16614891] Functional characterization of ketoreductase (rubN6) and aminotransferase (rubN4) genes in the gene cluster of Streptomyces achromogenes var. rubradiris. (Biotechnol Lett. , 2006)
ACC
Q9F837
NITE
Megalo_00050
PmId
[16514147] In vivo characterization of the dTDP-D-desosamine pathway of the megalomicin gene cluster from Micromonospora megalomicea. (Microbiology. , 2006)
[20418422] TDP-L-megosamine biosynthesis pathway elucidation and megalomicin a production in Escherichia coli. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 aminotransferase [NDP-deoxyhexose 3-aminotransferase]
MTTYVWDYLPEYENERDDLIDAVDTVFRSGRLILGPSVEGFESEFAAYHGLAHCAGVDNG
TNAVKLGLQALGVGPGDEVITVSNTAAPTVVAIDGTGATPVFVDIREQDFLMDTDQGAAA
ITPRTKVLLPVHLYGQCVDMAPLERLAAQHGLKILEDCAQSHGAHHHGRTAGTIGDAAAF
SFYPTKVLGAYGDAGAVVTDDPEVDAALRRLRYYGMAETYYVVQTPGHNSRLDEVQAEIL
RRKLRRLDTYIEGRRAVARRYEEGLGDLVAPDGLRLPVTAEGNDHVHYVYVVRHPRRDEI
IERLKGYGISLNISYPWPVHTMSGFAHLGYAPGSLPVTERLAGEIFSLPMYPSLSEDVQD
KVISALREVLTEGTRS
selected fasta
>putative NDP-hexose C-3 aminotransferase [NDP-deoxyhexose 3-aminotransferase]
ATGACCACCTACGTCTGGGACTACCTCCCGGAGTACGAGAACGAACGCGACGACCTCATC
GACGCGGTGGACACCGTCTTCCGCTCCGGCCGCCTCATCCTCGGCCCGTCGGTCGAGGGC
TTCGAGAGCGAGTTCGCCGCCTACCACGGCCTCGCGCACTGCGCCGGCGTGGACAACGGC
ACCAACGCCGTGAAGCTCGGCCTCCAGGCCCTCGGCGTCGGCCCCGGCGACGAGGTCATC
ACCGTCTCCAACACCGCCGCGCCCACCGTCGTCGCCATCGACGGCACCGGAGCCACCCCC
GTGTTCGTGGACATCCGCGAACAGGACTTCCTGATGGACACCGACCAGGGGGCGGCGGCC
ATCACCCCCCGGACCAAGGTCCTGCTGCCCGTCCACCTCTACGGCCAGTGCGTGGACATG
GCCCCGCTGGAGCGCCTCGCCGCACAGCACGGCCTGAAGATCCTCGAGGACTGCGCCCAG
TCGCACGGCGCCCACCACCACGGCCGGACGGCGGGCACCATCGGCGACGCCGCGGCCTTC
TCCTTCTACCCGACCAAGGTCCTCGGCGCGTACGGCGACGCCGGCGCGGTCGTCACCGAC
GACCCGGAGGTCGACGCCGCCCTGCGGCGCCTGCGCTACTACGGCATGGCGGAGACCTAC
TACGTCGTCCAGACCCCCGGACACAACTCCCGCCTCGACGAGGTGCAGGCCGAGATCCTC
CGGCGCAAGCTCCGCCGCCTCGACACCTACATCGAGGGCCGCCGGGCGGTCGCCCGCCGC
TACGAGGAGGGGCTCGGGGACCTCGTCGCGCCGGACGGGCTCCGGCTGCCCGTCACCGCC
GAGGGCAACGACCACGTCCACTACGTCTACGTCGTCCGCCACCCCCGGCGCGACGAGATC
ATCGAGCGGCTCAAGGGCTACGGCATCTCGCTGAACATCAGCTACCCCTGGCCGGTGCAC
ACGATGAGCGGCTTCGCACACCTCGGATACGCCCCGGGCTCGCTGCCCGTGACCGAGCGG
CTGGCCGGCGAGATCTTCTCCCTGCCGATGTACCCCTCGCTCTCCGAGGACGTCCAGGAC
AAGGTGATCTCCGCCCTGCGGGAGGTCCTCACCGAGGGGACCCGGTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [1-374]  1.39999277195148e-102 PIRSF000390
PIRSF000390   PLP_StrS
 [15-367]  4.30000000000003e-116 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [16-246]  9.00000000000011e-77 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [247-371]  4.10000000000004e-38 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [6-374]  3.30001976117415e-106 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit