close all open/close all

CDS information : Medem_00170


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction16,063 / 17,127 / + [in whole cluster]
16,063 / 17,127 / + [in contig]
Location16063..17127 [in whole cluster]
16063..17127 [in contig]
TypeCDS
Length1,065 bp (354 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)NDP-1-glucose synthase
Gene
Gene (GenBank)med-ORF18
EC number2.7.7.24
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Related Reference
ACC
Q2HR55
NITE
Sch475_00270
PmId
[18051285] Cloning and expression of glucose-1-phosphate thymidylyltransferase gene (schS6) from Streptomyces sp. SCC-2136. (J Microbiol Biotechnol. , 2007)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [NDP-1-glucose synthase]
MKALVLSGGAGTRLPPFSYSMPKQLIPIANKPVLEHVLENIRAVGITEVGVIVGDWADEI
AQVIGDGSRLGLRITLIPQEKPLGLAHCVALARPFLGDDDFVMYLGDNMLPGGIDTIAAD
FTARRPDALVVVHKVRDPPAFGVAELAPDGSVLRLVEKPERPRSDLALIGVYFFTAAIHE
AVAAIEPGARGELEITDAVQWLVAHGSHVAASEYDGYWKDTGRVEEVLACNRELLGDQTA
RVDGEVDAASRVTGRVVLEAGARLVRSTVTGPAVIGAGTVIEDSAVGPHTSIGRGCLLRD
TTLTDSIVMDGASITAVTGLQGSLIGRNAVVGAGAEGDGHRLVIGDHTRIEVAA
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [NDP-1-glucose synthase]
ATGAAGGCCCTCGTGCTGTCCGGCGGAGCGGGCACCCGCCTGCCCCCCTTCAGCTACTCG
ATGCCCAAGCAGCTCATCCCCATCGCCAACAAGCCCGTCCTCGAACACGTCCTGGAGAAC
ATCCGCGCGGTGGGCATCACCGAGGTCGGCGTCATCGTCGGCGACTGGGCCGACGAGATC
GCCCAGGTGATCGGCGACGGCTCCCGGCTGGGGCTGCGCATCACCCTGATCCCCCAGGAG
AAGCCGCTCGGCCTCGCGCACTGCGTCGCCCTCGCCCGGCCCTTCCTCGGCGACGACGAC
TTCGTGATGTACCTCGGCGACAACATGCTCCCGGGCGGGATCGACACGATCGCCGCCGAC
TTCACCGCCCGACGGCCCGACGCCCTGGTCGTCGTCCACAAGGTGCGCGACCCCCCGGCC
TTCGGCGTGGCCGAACTCGCCCCCGACGGGAGCGTGCTGCGGCTCGTGGAGAAGCCCGAG
CGGCCCAGGAGCGACCTGGCCCTCATCGGCGTGTACTTCTTCACCGCCGCCATCCACGAG
GCCGTCGCCGCCATCGAGCCCGGCGCCCGCGGCGAACTGGAGATCACCGACGCCGTCCAG
TGGCTCGTCGCCCACGGCTCGCACGTCGCGGCCAGCGAGTACGACGGGTACTGGAAGGAC
ACCGGCCGGGTCGAGGAGGTCCTCGCCTGCAACCGGGAGCTGCTCGGCGACCAGACGGCC
CGGGTGGACGGCGAGGTCGACGCGGCCAGCCGGGTGACCGGCCGCGTCGTGCTGGAGGCG
GGAGCCCGCCTCGTGCGTTCCACGGTCACCGGACCGGCCGTCATCGGCGCCGGCACGGTG
ATCGAGGACAGCGCGGTCGGACCCCACACCTCCATCGGCCGGGGCTGTCTCCTGCGCGAC
ACGACCCTGACCGACTCCATCGTCATGGACGGGGCCTCCATCACCGCCGTGACCGGCCTG
CAGGGCTCGCTGATCGGCCGCAACGCCGTCGTCGGCGCCGGCGCCGAGGGCGACGGGCAC
CGTCTCGTGATCGGCGACCACACCCGTATCGAGGTGGCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-234]  6.40000000000004e-50 PF00483
PF00483   NTP_transferase
IPR005908 Glucose-1-phosphate thymidylyltransferase, long form (Family)
 [2-351]  1.69999999999998e-122 TIGR01208
TIGR01208   RmlA_long
IPR011004 Trimeric LpxA-like (Domain)
 [267-351]  3.00000067992871e-06 SSF51161
SSF51161   Trimer_LpxA_like
SignalP
 [1-20]  0.226 Signal
Eukaryota   
TMHMM No significant hit