close all open/close all

CDS information : Medem_00180


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction17,124 / 18,125 / + [in whole cluster]
17,124 / 18,125 / + [in contig]
Location17124..18125 [in whole cluster]
17124..18125 [in contig]
TypeCDS
Length1,002 bp (333 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)NDP-glucose-4,6-dehydratase
Gene
Gene (GenBank)med-ORF17
EC number4.2.1.46
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Related Reference
ACC
Q56173
NITE
Grana_00110
PmId
[7476861] Identification of Streptomyces violaceoruber Tu22 genes involved in the biosynthesis of granaticin. (Mol Gen Genet. , 1995)
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [NDP-glucose-4,6-dehydratase]
MRVLVTGGAGFIGSHYVRTMLAGGYPGYEDARITVVDKLSYAGNRDNLPADHPRLDFVQG
DVCDLPLLLDVFPGHDGLVHFAAESHVDRSVESAAEFVRTNVGGTQTVLDACVETGIERV
VHVSTDEVYGSIETGSWTESRPLLPNSPYAASKAGADLVARSYWRTHRLDLSITRCSNNY
GSHQHPEKLVPLFVTNLLEGLPLPLYGDGRNVREWLHVDDHCRAVQLVLAHGGAGEIYNV
GGGNEITNLDLTRRLVELCGADESAIQPVADRKGHDLRYALDDGKIREQLGYEPLVPFDR
GLADTVAWYRENPQWWKPVKHRERTAPGPETGR
selected fasta
>putative dTDP-glucose 4,6-dehydratase [NDP-glucose-4,6-dehydratase]
ATGAGGGTGCTCGTCACGGGCGGCGCCGGCTTCATCGGCTCGCACTACGTCCGCACCATG
CTCGCGGGCGGCTACCCCGGCTACGAGGACGCGCGGATCACCGTCGTCGACAAGCTCAGC
TACGCGGGCAACCGGGACAACCTCCCGGCCGACCACCCCCGGCTGGACTTCGTCCAGGGC
GACGTCTGCGACCTCCCCCTGCTCCTCGACGTGTTCCCGGGCCACGACGGTCTCGTCCAC
TTCGCCGCCGAGTCGCACGTCGACCGCTCCGTGGAGTCCGCCGCCGAGTTCGTCCGCACG
AACGTCGGCGGCACCCAGACGGTCCTCGACGCCTGCGTCGAGACCGGCATCGAGCGGGTC
GTCCACGTCTCGACCGACGAGGTGTACGGATCGATCGAGACGGGCTCCTGGACGGAGAGC
CGGCCGCTCCTTCCCAACTCCCCCTACGCGGCCTCGAAGGCGGGAGCCGACCTGGTGGCC
CGCTCCTACTGGCGCACCCACCGGCTCGACCTCTCCATCACCCGCTGCTCGAACAACTAC
GGTTCCCACCAGCACCCCGAGAAGCTCGTCCCGCTGTTCGTCACCAACCTCCTCGAAGGC
CTGCCCCTGCCGCTCTACGGAGACGGCCGCAACGTCCGCGAGTGGCTGCACGTCGACGAC
CACTGCCGGGCGGTCCAGCTCGTCCTCGCCCACGGCGGAGCCGGCGAGATCTACAACGTC
GGCGGCGGCAACGAGATCACCAACCTCGACCTCACCCGCCGGCTCGTCGAGCTCTGCGGC
GCCGACGAGTCCGCGATCCAGCCGGTCGCCGACCGCAAGGGCCACGACCTCCGCTACGCC
CTGGACGACGGCAAGATCCGGGAACAGCTCGGCTACGAGCCCCTCGTCCCCTTCGACCGG
GGCCTCGCGGACACCGTCGCCTGGTACCGGGAGAACCCCCAGTGGTGGAAGCCGGTGAAA
CACCGGGAGCGGACCGCCCCCGGCCCGGAGACGGGCAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [3-241]  3.5e-63 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [2-319]  2.20000000000002e-121 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [1-188]  3.09999999999998e-64 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit