close all open/close all

CDS information : Medem_00190


close this sectionLocation

Organism
StrainAM-7161
Entry nameMedermycin
Contig
Start / Stop / Direction18,122 / 19,561 / + [in whole cluster]
18,122 / 19,561 / + [in contig]
Location18122..19561 [in whole cluster]
18122..19561 [in contig]
TypeCDS
Length1,440 bp (479 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose 2,3-dehydratase
Product (GenBank)NDP-deoxyglucose-2,3-dehydratase
Gene
Gene (GenBank)med-ORF16
EC number
Keyword
  • angolosamine
Note
Note (GenBank)
  • GTG start codon
Reference
ACC
PmId
[12855716] Cloning, sequencing and heterologous expression of the medermycin biosynthetic gene cluster of Streptomyces sp. AM-7161: towards comparative analysis of the benzoisochromanequinone gene clusters. (Microbiology. , 2003)
Related Reference
ACC
Q845B8
PmId
[12889805] Functional identification of rub52 gene involved in the biosynthesis of rubradirin. (Biotechnol Lett. , 2003)
ACC
Q9ALN6
NITE
Spino_00070
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose 2,3-dehydratase [NDP-deoxyglucose-2,3-dehydratase]
MTGTPDTATRAALPGPDPATAALRRRAETGLAERLARSAAATEGAGPRTDEVADWLADPV
RAHRFRVDRIPFAALDGWSFAPGSGNLVHRSGRFFSVEGVGVTVDHGPFPQWQQPIIHQP
EVGILGILAKEIDGVLHFLMQAKMEPGNRNLLQLSPTVQATRSNYTKVHKGADVRYLEYF
LGHGRGRVLADVLQSEHGSWFLRKANRNVLVETDEDVPAHEDFRWLTLGQIGRLLRLDNL
VNMDARTVLAGLPTSSADDRLARALHTDRELLSWITAQRARHEVRVERLPLAEVRGWHRT
ATAVERADGRYFRVVAVAVEAGSRETADWTQPLIEPTGRGVTAFLNPRFGGVPHLLVHAR
GEAGLLDVLELAPTVQYVPENYAHLDPDDRPPFLAEVLAADPRRIRYEAVHSEEGGRFLD
AESRYLVVEADPGTPPDPPEGYLWVTPGQLGALAQHARYVNVQARTLLACINAGAVGPL
selected fasta
>putative NDP-hexose 2,3-dehydratase [NDP-deoxyglucose-2,3-dehydratase]
GTGACCGGCACCCCGGACACCGCCACCCGGGCGGCGCTGCCCGGGCCGGACCCCGCGACG
GCGGCACTGCGCCGCCGCGCGGAGACCGGCCTGGCCGAGCGGCTCGCCCGCTCGGCCGCC
GCGACGGAGGGAGCCGGACCCCGCACGGACGAGGTCGCCGACTGGCTGGCGGACCCCGTG
CGGGCCCACCGGTTCCGGGTCGACCGCATCCCCTTCGCCGCCCTCGACGGCTGGTCGTTC
GCACCGGGCTCCGGGAACCTCGTCCACCGCAGCGGCCGGTTCTTCTCGGTCGAGGGCGTC
GGCGTCACCGTCGACCACGGGCCCTTCCCGCAATGGCAGCAGCCCATCATCCACCAGCCC
GAGGTCGGCATCCTCGGCATCCTGGCCAAGGAGATCGACGGAGTCCTGCACTTCCTGATG
CAGGCGAAGATGGAGCCGGGCAACCGGAACCTGCTCCAGCTCTCCCCGACGGTCCAGGCC
ACCCGCAGCAACTACACCAAGGTGCACAAGGGCGCGGACGTGCGCTACCTGGAGTACTTC
CTCGGGCACGGTCGCGGGCGGGTGCTCGCCGACGTCCTCCAGTCCGAGCACGGCTCCTGG
TTCCTGCGCAAGGCCAACCGGAACGTCCTCGTGGAGACCGACGAGGACGTGCCGGCGCAC
GAGGACTTCCGCTGGCTGACCCTCGGTCAGATCGGACGGCTCCTCCGGCTCGACAACCTC
GTCAACATGGACGCGCGCACCGTCCTCGCCGGGCTGCCGACCTCCTCCGCCGACGACCGC
CTCGCCCGGGCGCTGCACACCGACCGCGAACTGCTCTCCTGGATCACCGCCCAACGCGCC
CGCCACGAGGTCCGCGTGGAGCGGCTCCCGCTCGCCGAGGTGCGCGGCTGGCACCGTACC
GCCACCGCCGTCGAGCGCGCGGACGGCCGCTACTTCCGCGTGGTGGCCGTGGCCGTCGAG
GCCGGCAGCCGCGAGACCGCCGACTGGACGCAGCCGCTCATCGAACCGACCGGGCGGGGC
GTGACCGCCTTCCTCAACCCCCGCTTCGGCGGCGTCCCCCACCTCCTGGTGCACGCGCGC
GGGGAGGCCGGCCTGCTCGACGTCCTGGAGCTGGCCCCCACCGTGCAGTACGTCCCGGAG
AACTACGCCCACCTCGACCCCGACGACCGGCCGCCGTTCCTGGCGGAGGTCCTCGCGGCC
GACCCCCGGCGCATCCGCTACGAGGCGGTCCACTCCGAGGAGGGCGGCCGGTTCCTCGAC
GCCGAGAGCCGCTATCTCGTCGTCGAGGCCGACCCCGGGACCCCGCCCGACCCGCCGGAG
GGCTACCTGTGGGTCACCCCCGGCCAGCTGGGAGCCCTCGCCCAGCACGCGCGCTATGTG
AACGTCCAGGCCCGCACGCTGCTCGCCTGCATCAACGCAGGTGCCGTCGGGCCGCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [49-252]  2.70000000000002e-86 PF03559 [266-471]  3.99999999999998e-79 PF03559
PF03559   Hexose_dehydrat
SignalP
 [1-41]  0.122 Signal
Bacteria, Gram-negative   
 [1-32]  0.189 Signal
Bacteria, Gram-positive   
TMHMM No significant hit